EWSR1 Antibody (9G3H1)

Western Blot: EWSR1 Antibody (9G3H1) [NBP3-16845] - Western blot analysis of extracts of various cell lines, using EWSR1 Rabbit mAb (NBP3-16845) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of U-2 OS cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of C6 cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of NIH-3T3 cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human breast cancer tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded rat colon tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse kidney tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse lung tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse colon tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human thyroid tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded rat spleen tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human tonsil tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human breast tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse heart tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse liver tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clone: 9G3H1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

EWSR1 Antibody (9G3H1) Summary

• Description: Novus Biologicals Rabbit EWSR1 Antibody (9G3H1) (NBP3-16845) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human EWSR1 (Q01844). MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPS
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: EWSR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EWSR1 Antibody (9G3H1)

• bK984G1.4
• Ewing sarcoma breakpoint region 1 protein
• Ewing sarcoma breakpoint region 1
• Ewings sarcoma EWS-Fli1 (type 1) oncogene
• EWS oncogene
• EWS
• EWSR1
• EWSRNA-binding protein EWS

Background

The EWSR1 gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EWSR1