ESD Antibody


Western Blot: ESD Antibody [NBP1-57596] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human kidney
Immunohistochemistry: ESD Antibody [NBP1-57596] - Formalin Fixed Paraffin Embedded Tissue: Human Heart Tissue Observed Staining: Cytoplasm in endothelial and smooth muscle cells in arterioles Primary Antibody more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC

Order Details

ESD Antibody Summary

Synthetic peptides corresponding to ESD(esterase D/formylglutathione hydrolase) The peptide sequence was selected from the N terminal of ESD. Peptide sequence MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against ESD and was validated on Western blot.
ESD Lysate (NBP2-65703)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ESD Antibody

  • EC
  • esterase 10
  • esterase Desterase D/formylglutathione hydrolase
  • FGH
  • FLJ11763
  • S-formylglutathione hydrolase


ESD is a serine hydrolase involved in the detoxification of formaldehyde.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP

Publications for ESD Antibody (NBP1-57596) (0)

There are no publications for ESD Antibody (NBP1-57596).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ESD Antibody (NBP1-57596) (0)

There are no reviews for ESD Antibody (NBP1-57596). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ESD Antibody (NBP1-57596) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ESD Antibody (NBP1-57596)

Discover related pathways, diseases and genes to ESD Antibody (NBP1-57596). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ESD Antibody (NBP1-57596)

Discover more about diseases related to ESD Antibody (NBP1-57596).

Pathways for ESD Antibody (NBP1-57596)

View related products by pathway.

PTMs for ESD Antibody (NBP1-57596)

Learn more about PTMs related to ESD Antibody (NBP1-57596).

Blogs on ESD

There are no specific blogs for ESD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ESD Antibody and receive a gift card or discount.


Gene Symbol ESD