ERP29 Antibody - BSA Free

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining in human prostate and skeletal muscle tissues using anti-ERP29 antibody. Corresponding ERP29 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining of human cerebral cortex, lymph node, prostate and skeletal muscle using Anti-ERP29 antibody NBP1-88396 (A) shows similar protein distribution across tissues to independent antibody NBP1-88395 (B).

Western Blot: ERP29 Antibody [NBP1-88396] - Analysis using Anti-ERP29 antibody NBP1-88396 (A) shows similar pattern to independent antibody NBP1-88395 (B).

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining of human skeletal muscle using Anti-ERP29 antibody NBP1-88396.

Western Blot: ERP29 Antibody [NBP1-88396] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining of human prostate shows high expression.

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining of human lymph node.

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: ERP29 Antibody [NBP1-88396] - Staining of human prostate using Anti-ERP29 antibody NBP1-88396.

Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ERP29 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ERP29 Antibody - BSA Free (NBP1-88396) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLD
• Marker: Endoplasmic Reticulum Marker
• Predicted Species: Mouse (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERP29
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ERP29 Protein (NBP1-88396PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ERP29 Antibody - BSA Free

• C12orf8chromosome 12 open reading frame 8
• endoplasmic reticulum lumenal protein ERp28
• endoplasmic reticulum protein 29
• Endoplasmic reticulum resident protein 28
• endoplasmic reticulum resident protein 29
• ERp28Endoplasmic reticulum resident protein 31
• ERp29
• ERp31ERP28
• PDIA9
• PDI-DB
• protein disulfide isomerase family A, member 9

Background

ERP29 encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERP29
• Entrez:
  • 10961(Human)
• Uniprot:
  • P30040(Human)