DNAJC3 Antibody

Images

 
Western Blot: DNAJC3 Antibody [NBP2-48704] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: DNAJC3 Antibody [NBP2-48704] - Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: DNAJC3 Antibody [NBP2-48704] - Staining of human thyroid gland shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVR
Predicted Species
Mouse (99%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNAJC3 Recombinant Protein Antigen (NBP2-48704PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAJC3 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 3
  • HP58
  • Interferon-induced, double-stranded RNA-activated protein kinase inhibitor
  • P58FLJ21288
  • P58IPKProtein kinase inhibitor p58
  • PRKRIdnaJ homolog subfamily C member 3
  • Protein kinase inhibitor of 58 kDa
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor

Background

The 58-kDa inhibitor of the interferon-induced double-stranded RNA-activated protein kinase (PKR) is a cellular protein that is activated during influenza virus infection to down-regulate the activity of PKR. The 58-kDa inhibitor of the interferon-induced double-stranded RNA-activated protein kinase (PKR) is a cellular protein that is activated during influenza virus infection to down-regulate the activity of PKR (1). The P58 protein inhibits both the autophosphorylation of PKR and the phosphorylation of the PKR natural substrate, the alpha subunit of eukaryotic initiation factor eIF-2. Sequence analysis revealed that P58 is a member of the tetratricopeptide family of proteins (2). Also, like other J-domain proteins, P58 stimulated the ATPase activity of Hsc70. Taken together, data suggests that P58 is a co-chaperone, possibly directing hsp/Hsc70 to refold, and thus inhibit kinase function (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-03381
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
MAB1058
Species: Hu
Applications: Block, CyTOF-ready, Flow
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1543
Species: Hu
Applications: IHC, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-50419
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IP, WB
NB100-496
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-92609
Species: Hu, Mu
Applications: ICC/IF, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-86684
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-48704
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNAJC3 Antibody (NBP2-48704) (0)

There are no publications for DNAJC3 Antibody (NBP2-48704).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC3 Antibody (NBP2-48704) (0)

There are no reviews for DNAJC3 Antibody (NBP2-48704). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJC3 Antibody (NBP2-48704) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC3 Products

Bioinformatics Tool for DNAJC3 Antibody (NBP2-48704)

Discover related pathways, diseases and genes to DNAJC3 Antibody (NBP2-48704). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC3 Antibody (NBP2-48704)

Discover more about diseases related to DNAJC3 Antibody (NBP2-48704).
 

Pathways for DNAJC3 Antibody (NBP2-48704)

View related products by pathway.

PTMs for DNAJC3 Antibody (NBP2-48704)

Learn more about PTMs related to DNAJC3 Antibody (NBP2-48704).
 

Research Areas for DNAJC3 Antibody (NBP2-48704)

Find related products by research area.

Blogs on DNAJC3

There are no specific blogs for DNAJC3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC3