epithelial Sodium Channel alpha Antibody

Images

 
Immunohistochemistry-Paraffin: epithelial Sodium Channel alpha Antibody [NBP1-84846] - Staining of human gall bladder shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

epithelial Sodium Channel alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCNN1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
epithelial Sodium Channel alpha Protein (NBP1-84846PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for epithelial Sodium Channel alpha Antibody

  • alpha ENaC-2
  • alpha-ENaC
  • alpha-NaCH
  • amiloride-sensitive epithelial sodium channel alpha subunit
  • amiloride-sensitive sodium channel subunit alpha 2
  • amiloride-sensitive sodium channel subunit alpha
  • BESC2
  • ENaCa
  • ENaCalpha
  • Epithelial Na(+) channel subunit alpha
  • FLJ21883
  • nasal epithelial sodium channel alpha subunit
  • Nonvoltage-gated sodium channel 1 subunit alpha
  • SCNEA
  • SCNN1
  • sodium channel, nonvoltage-gated 1 alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41371
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P, S-ELISA, ELISA(Cap)
NBP1-84844
Species: Hu
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, B/N, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1566
Species: Hu
Applications: WB, IP
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-40845
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84846
Species: Hu
Applications: IHC, IHC-P

Publications for epithelial Sodium Channel alpha Antibody (NBP1-84846) (0)

There are no publications for epithelial Sodium Channel alpha Antibody (NBP1-84846).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for epithelial Sodium Channel alpha Antibody (NBP1-84846) (0)

There are no reviews for epithelial Sodium Channel alpha Antibody (NBP1-84846). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for epithelial Sodium Channel alpha Antibody (NBP1-84846) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional epithelial Sodium Channel alpha Products

Bioinformatics Tool for epithelial Sodium Channel alpha Antibody (NBP1-84846)

Discover related pathways, diseases and genes to epithelial Sodium Channel alpha Antibody (NBP1-84846). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for epithelial Sodium Channel alpha Antibody (NBP1-84846)

Discover more about diseases related to epithelial Sodium Channel alpha Antibody (NBP1-84846).
 

Pathways for epithelial Sodium Channel alpha Antibody (NBP1-84846)

View related products by pathway.

PTMs for epithelial Sodium Channel alpha Antibody (NBP1-84846)

Learn more about PTMs related to epithelial Sodium Channel alpha Antibody (NBP1-84846).

Blogs on epithelial Sodium Channel alpha

There are no specific blogs for epithelial Sodium Channel alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our epithelial Sodium Channel alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCNN1A