NKCC2/SLC12A1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Analysis in human kidney and pancreas tissues using NBP1-80993 antibody. Corresponding SLC12A1 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum, kidney, liver and pancreas using Anti-SLC12A1 antibody NBP1-80993 (A) shows similar ...read more
Western Blot: NKCC2/SLC12A1 Antibody [NBP1-80993] - Western blot experiments were performed to determine the protein expression in eight corresponding normal (N) and clear cell renal cell carcinoma (T) tissue. NPTX2 was ...read more
Immunocytochemistry/ Immunofluorescence: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cell line RPTEC TERT1 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKCC2/SLC12A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC12A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 26831905). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
NKCC2/SLC12A1 Protein (NBP1-80993PEP)
Publications
Read Publication using
NBP1-80993 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NKCC2/SLC12A1 Antibody

  • BSC1
  • Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
  • Kidney-specific Na-K-Cl symporter
  • MGC48843
  • NKCC2
  • NKCC2A variant A
  • NKCC2Na-K-2Cl cotransporter
  • SLC12A1
  • solute carrier family 12 (sodium/potassium/chloride transporters), member 1
  • solute carrier family 12 member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-44270
Species: Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, WB
NB100-75623
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: IHC, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-81529
Species: Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IP, KD, KO, Simple Western, WB
NBP1-82016
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001188-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NB600-749
Species: Hu, Mu, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF009
Species: Hu
Applications: IHC, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB5175
Species: Mu
Applications: IHC, WB
NBP2-49101
Species: Hu
Applications: IHC, IHC-P
H00009943-M16
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-80993
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NKCC2/SLC12A1 Antibody (NBP1-80993)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NKCC2/SLC12A1 Antibody (NBP1-80993) (0)

There are no reviews for NKCC2/SLC12A1 Antibody (NBP1-80993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NKCC2/SLC12A1 Antibody (NBP1-80993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NKCC2/SLC12A1 Products

Bioinformatics Tool for NKCC2/SLC12A1 Antibody (NBP1-80993)

Discover related pathways, diseases and genes to NKCC2/SLC12A1 Antibody (NBP1-80993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKCC2/SLC12A1 Antibody (NBP1-80993)

Discover more about diseases related to NKCC2/SLC12A1 Antibody (NBP1-80993).
 

Pathways for NKCC2/SLC12A1 Antibody (NBP1-80993)

View related products by pathway.

PTMs for NKCC2/SLC12A1 Antibody (NBP1-80993)

Learn more about PTMs related to NKCC2/SLC12A1 Antibody (NBP1-80993).
 

Research Areas for NKCC2/SLC12A1 Antibody (NBP1-80993)

Find related products by research area.

Blogs on NKCC2/SLC12A1

There are no specific blogs for NKCC2/SLC12A1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKCC2/SLC12A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A1
Entrez
Uniprot