NKCC2/SLC12A1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cell line RPTEC TERT1 shows localization to nucleus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining in human kidney and lymph node tissues using anti-SLC12A1 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebral cortex, kidney, liver and lymph node using Anti-SLC12A1 antibody NBP1-80993 (A) shows similar protein distribution across ...read more
Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NKCC2/SLC12A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSI
Specificity
Specificity of human NKCC2/SLC12A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC12A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NKCC2/SLC12A1 Protein (NBP1-80993PEP)
Publications
Read Publication using
NBP1-80993 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NKCC2/SLC12A1 Antibody

  • BSC1
  • Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
  • Kidney-specific Na-K-Cl symporter
  • MGC48843
  • NKCC2
  • NKCC2A variant A
  • NKCC2Na-K-2Cl cotransporter
  • SLC12A1
  • solute carrier family 12 (sodium/potassium/chloride transporters), member 1
  • solute carrier family 12 member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86376
Species: Hu
Applications: IHC, IHC-P
NB100-75623
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Po, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001188-P01
Species: Hu
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45552
Species: Hu
Applications: WB, IHC
NB600-749
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33393
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-62634
Species: Hu
Applications: IHC, IHC-P
NBP1-82929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NKCC2/SLC12A1 Antibody (NBP1-80993)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NKCC2/SLC12A1 Antibody (NBP1-80993) (0)

There are no reviews for NKCC2/SLC12A1 Antibody (NBP1-80993). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NKCC2/SLC12A1 Antibody (NBP1-80993) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NKCC2/SLC12A1 Antibody (NBP1-80993)

Discover related pathways, diseases and genes to NKCC2/SLC12A1 Antibody (NBP1-80993). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKCC2/SLC12A1 Antibody (NBP1-80993)

Discover more about diseases related to NKCC2/SLC12A1 Antibody (NBP1-80993).
 

Pathways for NKCC2/SLC12A1 Antibody (NBP1-80993)

View related products by pathway.

PTMs for NKCC2/SLC12A1 Antibody (NBP1-80993)

Learn more about PTMs related to NKCC2/SLC12A1 Antibody (NBP1-80993).

Blogs on NKCC2/SLC12A1

There are no specific blogs for NKCC2/SLC12A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NKCC2/SLC12A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A1
Entrez
Uniprot