NKCC2/SLC12A1 Antibody

Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Analysis in human kidney and pancreas tissues using NBP1-80993 antibody. Corresponding SLC12A1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum, kidney, liver and pancreas using Anti-SLC12A1 antibody NBP1-80993 (A) shows similar protein distribution across tissues to independent antibody NBP1-82559 (B).

Western Blot: NKCC2/SLC12A1 Antibody [NBP1-80993] - Western blot experiments were performed to determine the protein expression in eight corresponding normal (N) and clear cell renal cell carcinoma (T) tissue. NPTX2 was increased in tumor tissue, whereas FXYD4, KNG1, SLC12A1 and SLC6A3 were decreased in tumors. NDUF4AL2 levels were similar, but the bands were of different size in tumor and normal samples Image collected and cropped by CiteAb from the following publication (//molecular-cancer.biomedcentral.com/articles/10.1186/s12943-016-0495-5), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cell line RPTEC TERT1 shows localization to nucleus & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.

Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: NKCC2/SLC12A1 Antibody [NBP1-80993] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NKCC2/SLC12A1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MSLNNSSNVFLDSVPSNTNRFQVSVINENHESSAAADDNTDPPHYEETSFGDEAQKRLRISFRPGNQECYDNFLQSGETAKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC12A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 26831905). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  NKCC2/SLC12A1 Protein (NBP1-80993PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NKCC2/SLC12A1 Antibody

• BSC1
• Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
• Kidney-specific Na-K-Cl symporter
• MGC48843
• NKCC2
• NKCC2A variant A
• NKCC2Na-K-2Cl cotransporter
• SLC12A1
• solute carrier family 12 (sodium/potassium/chloride transporters), member 1
• solute carrier family 12 member 1

Background

The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NKCC2/SLC12A1 Antibody (NBP1-80993)(1)

Publication using NBP1-80993

• Schrodter S, Braun M, Syring I et al. Identification of the dopamine transporter SLC6A3 as a biomarker for patients with renal cell carcinoma Mol. Cancer 2016-02-02 [PMID: 26831905] (WB, Human)

Bioinformatics

• Gene Symbol: SLC12A1
• Entrez:
  • 6557(Human)
• Uniprot:
  • Q13621(Human)