Ephrin-B3 Antibody

Images

 
Western Blot: Ephrin-B3 Antibody [NBP3-10672] - Western blot analysis of Ephrin-B3 in Mouse Spleen lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ephrin-B3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ephrin-B3 (NP_031937). Peptide sequence AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE
Clonality
Polyclonal
Host
Rabbit
Gene
EFNB3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
36 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for Ephrin-B3 Antibody

  • EFL-6
  • Efnb3
  • Elk-L3
  • EPH-related receptor tyrosine kinase ligand 8
  • Ephrin B3
  • EphrinB3
  • Ephrin-B3
  • Epl8
  • EPLG8EPH-related receptor transmembrane ligand ELK-L3
  • LERK-8
  • LERK8EFL6
  • NLERK-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

496-EB
Species: Mu
Applications: Bind
473-EB
Species: Mu
Applications: Bind
AF3034
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF432
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF641
Species: Mu
Applications: IHC, WB
AF611
Species: Mu
Applications: WB
AF1056
Species: Rt
Applications: IHC, WB
1596-B1
Species: Rt
Applications: Bind
AF446
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
AF3035
Species: Hu
Applications: CyTOF-ready, Flow, IHC, KO, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB200-109
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
AF369
Species: Hu
Applications: ICC, IHC, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP
NBP3-10672
Species: Mu
Applications: WB

Publications for Ephrin-B3 Antibody (NBP3-10672) (0)

There are no publications for Ephrin-B3 Antibody (NBP3-10672).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ephrin-B3 Antibody (NBP3-10672) (0)

There are no reviews for Ephrin-B3 Antibody (NBP3-10672). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ephrin-B3 Antibody (NBP3-10672) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ephrin-B3 Products

Bioinformatics Tool for Ephrin-B3 Antibody (NBP3-10672)

Discover related pathways, diseases and genes to Ephrin-B3 Antibody (NBP3-10672). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ephrin-B3 Antibody (NBP3-10672)

Discover more about diseases related to Ephrin-B3 Antibody (NBP3-10672).
 

Pathways for Ephrin-B3 Antibody (NBP3-10672)

View related products by pathway.

PTMs for Ephrin-B3 Antibody (NBP3-10672)

Learn more about PTMs related to Ephrin-B3 Antibody (NBP3-10672).

Blogs on Ephrin-B3.

Identifying tumoral and stromal transcriptomes that underlie tumor plasticity and stromal neuroinflammatory response in brain metastasis
By Jamshed Arslan, Pharm. D., PhD. Cancers in the brain often come from tumors elsewhere in the body. Several adaptive mechanisms influence brain metastasis, such as blood brain barrier leakage that can be induced by ...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ephrin-B3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EFNB3