EphB3 Antibody (8H9P4)

Western Blot: EphB3 Antibody (8H9P4) [NBP3-15693] - Western blot analysis of extracts of various cell lines, using EphB3 (EPHB3) antibody (NBP3-15693) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Western Blot: EphB3 Antibody (8H9P4) [NBP3-15693] - Western blot analysis of extracts of Mouse brain, using EphB3 (EPHB3) antibody (NBP3-15693) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 8H9P4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

EphB3 Antibody (8H9P4) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EphB3 (EPHB3) (P54753). SELAWTSHPESGWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWM
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: EPHB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EphB3 Antibody (8H9P4)

• Cek10
• EC 2.7.10
• EC 2.7.10.1
• EK2
• EPH receptor B3
• EphB3
• EPH-like kinase 2
• EPH-like tyrosine kinase-2
• ephrin type-B receptor 3
• ETK2Hek2
• Hek2
• human embryo kinase 2
• Mdk5
• Sek4
• Tyro6
• Tyrosine-protein kinase TYRO6

Background

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPHB3