ENPP-3/CD203c Antibody


Immunohistochemistry-Paraffin: ENPP-3/CD203c Antibody [NBP1-88928] - Staining of human uterus shows distinct membranous positivity in glandular cells with extracellular staining.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ENPP-3/CD203c Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ENPP-3/CD203c Protein (NBP1-88928PEP)

Reactivity Notes

Mouse (82%), Rat (82%).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ENPP-3/CD203c Antibody

  • B10
  • CD203c antigen
  • CD203c
  • dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)
  • dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3)
  • ectonucleotide pyrophosphatase/phosphodiesterase 3
  • ectonucleotide pyrophosphatase/phosphodiesterase family member 3
  • E-NPP 3
  • ENPP3
  • ENPP-3
  • gp130RB13-6
  • NPP3
  • PDNP3
  • PDNP3B10
  • Phosphodiesterase I beta
  • Phosphodiesterase I/nucleotide pyrophosphatase 3
  • phosphodiesterase-I beta


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA, PLA
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Ca
Applications: WB, DB, EM, ELISA, Flow, Func, ICC/IF, IP
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for ENPP-3/CD203c Antibody (NBP1-88928) (0)

There are no publications for ENPP-3/CD203c Antibody (NBP1-88928).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENPP-3/CD203c Antibody (NBP1-88928) (0)

There are no reviews for ENPP-3/CD203c Antibody (NBP1-88928). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ENPP-3/CD203c Antibody (NBP1-88928) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ENPP-3/CD203c Products

Bioinformatics Tool for ENPP-3/CD203c Antibody (NBP1-88928)

Discover related pathways, diseases and genes to ENPP-3/CD203c Antibody (NBP1-88928). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENPP-3/CD203c Antibody (NBP1-88928)

Discover more about diseases related to ENPP-3/CD203c Antibody (NBP1-88928).

Pathways for ENPP-3/CD203c Antibody (NBP1-88928)

View related products by pathway.

PTMs for ENPP-3/CD203c Antibody (NBP1-88928)

Learn more about PTMs related to ENPP-3/CD203c Antibody (NBP1-88928).

Research Areas for ENPP-3/CD203c Antibody (NBP1-88928)

Find related products by research area.

Blogs on ENPP-3/CD203c

There are no specific blogs for ENPP-3/CD203c, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ENPP-3/CD203c Antibody and receive a gift card or discount.


Gene Symbol ENPP3