Endoglin/CD105 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Endoglin/CD105 Antibody - BSA Free (NBP1-91212) is a polyclonal antibody validated for use in IHC and WB. Anti-Endoglin/CD105 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRK |
| Marker |
Neo-endothelial Cells Marker |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ENG |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Reactivity reported in scientific literature (PMID: 23147994)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Endoglin/CD105 Antibody - BSA Free
Background
CD105 is a 90 kD homodimeric type I integral membrane glycoprotein, also known as endoglin. It is expressed on endothelial cells (especially on angiogenic endothelial cells) and up-regulated by hypoxia, activated monocytes, macrophages, bone marrow stromal cells, and some cytotrophoblasts. CD105 is a receptor for TGF- szlig1, TGF- szlig3 and modulates TGF- szlig signaling by interacting with TGF- szlig receptors I and/or II. CD105 also binds other growth factors such as actvin A, BMP-2 and -7. CD105 has been show to be a useful marker for identifying proliferating endothelium involved in tumor angiogenesis and can be used for tumor imaging, prognosis, as well as has therapeutic potential for some solid tumors and other angiogenic diseases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ELISA
Species: Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Ca, Hu, Po
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB, IHC
Publications for Endoglin/CD105 Antibody (NBP1-91212)(1)
Showing Publication 1 -
1 of 1.
Reviews for Endoglin/CD105 Antibody (NBP1-91212) (0)
There are no reviews for Endoglin/CD105 Antibody (NBP1-91212).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Endoglin/CD105 Antibody (NBP1-91212). (Showing 1 - 2 of 2 FAQ).
-
I wonder if you have a CD105 or CD34 antibody suitable for IHC that is specific for human and do not bind mouse?
- We do not have any anti-human CD34 or CD105 antibodies that are confirmed to NOT detect the mouse protein. When we have tested an antibody and confirmed that it will not react with mouse samples, we will add Mu(-) to the datasheet, and unfortunately all of our CD105 and CD34 antibodies will either detect the mouse protein, or they have not been used in mouse samples before.
-
We are interested in CD105 antibodies that could react with dog, please let me know which products in your catalog you would recommend.
- We do not currently carry any CD105 antibodies that have been validated for use in dog samples. However, if you are interested in testing any of our CD105 antibodies with dog samples you would be eligible for our Innovators Reward Program, in which you can get a discount voucher for the purchase price of the product. Please contact us at innovators@novusbio.com with any questions regarding this program.
Secondary Antibodies
| |
Isotype Controls
|
Additional Endoglin/CD105 Products
Research Areas for Endoglin/CD105 Antibody (NBP1-91212)
Find related products by research area.
|
Blogs on Endoglin/CD105