Endocan/ESM-1 Antibody (6D4) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Endocan/ESM-1 Antibody (6D4) - Azide and BSA Free (H00011082-M02) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-Endocan/ESM-1 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
ESM1 (NP_008967, 85 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR |
| Specificity |
ESM1 - endothelial cell-specific molecule 1 |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
ESM1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Endocan/ESM-1 Antibody (6D4) - Azide and BSA Free
Background
This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: AdBlk, IHC, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Fe, Hu, RM
Applications: BA, BA
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Publications for Endocan/ESM-1 Antibody (H00011082-M02)(5)
Showing Publications 1 -
5 of 5.
| Publications using H00011082-M02 |
Applications |
Species |
| Scuruchi, M;Aliqu�, F;Avenoso, A;Mandraffino, G;Vermiglio, G;Minuti, A;Campo, S;Campo, GM;D'Ascola, A; Endocan Knockdown Down-Regulates the Expression of Angiogenesis-Associated Genes in Il-1� Activated Chondrocytes Biomolecules 2023-05-18 [PMID: 37238720] |
|
|
| Lai CY, Chen CM, Hsu WH et al. Overexpression of Endothelial Cell-Specific Molecule 1 Correlates with Gleason Score and Expression of Androgen Receptor in Prostate Carcinoma. Int J Med Sci 2017-09-30 [PMID: 29104483] |
|
|
| Kang YH, Ji NY, Lee CI et al. ESM-1 silencing decreased cell survival, migration, and invasion and modulated cell cycle progression in hepatocellular carcinoma. Amino Acids. 2010-09-07 [PMID: 20821239] |
|
|
| Ji NY, Kim YH, Jang YJ et al. Identification of endothelial cell-specific molecule-1 as a potential serum marker for colorectal cancer. Cancer Sci. 2010-07-30 [PMID: 20735430] |
|
|
| Liu N, Zhang LH, Du H et al. Overexpression of Endothelial Cell Specific Molecule-1 (ESM-1) in Gastric Cancer. Ann Surg Oncol. 2010-04-10 [PMID: 20383661] |
|
|
Reviews for Endocan/ESM-1 Antibody (H00011082-M02) (0)
There are no reviews for Endocan/ESM-1 Antibody (H00011082-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Endocan/ESM-1 Antibody (H00011082-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Endocan/ESM-1 Products
Research Areas for Endocan/ESM-1 Antibody (H00011082-M02)
Find related products by research area.
|
Blogs on Endocan/ESM-1