EMP/MAEA Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EMP/MAEA Antibody [NBP2-55034] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: EMP/MAEA Antibody [NBP2-55034] - Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EMP/MAEA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EMP/MAEA Antibody - BSA Free (NBP2-55034) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKL
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAEA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EMP/MAEA Recombinant Protein Antigen (NBP2-55034PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EMP/MAEA Antibody - BSA Free

• EMLP
• EMP
• EMPCell proliferation-inducing gene 5 protein
• Erythroblast macrophage protein
• HLC-10
• Human lung cancer oncogene 10 protein
• lung cancer-related protein 10
• macrophage erythroblast attacher
• MAEA
• PIG5
• proliferation-inducing gene 5

Background

The MAEA gene product mediates the attachment of erythroblasts to macrophages. This attachment promotes terminal maturationand enucleation of erythroblasts, presumably by suppressing apoptosis. This protein is an integral membrane proteinwith the N-terminus o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAEA