ELF2 Antibody - BSA Free

Western Blot: ELF2 Antibody [NBP2-49646] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG

Immunocytochemistry/Immunofluorescence: ELF2 Antibody [NBP2-49646] - Staining of human cell line RT4 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human testis.

Immunohistochemistry: ELF2 Antibody [NBP2-49646] - Staining of human duodenum shows nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human colon, lymph node, placenta and testis using Anti-ELF2 antibody NBP2-49646 (A) shows similar protein distribution across tissues to independent antibody NBP1-84770 (B).

Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human colon.

Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human placenta.

Immunohistochemistry-Paraffin: ELF2 Antibody [NBP2-49646] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ELF2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEEKPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
• Predicted Species: Mouse (91%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ELF2 Recombinant Protein Antigen (NBP2-49646PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ELF2 Antibody - BSA Free

• b
• E74-like factor 2 (ets domain transcription factor)
• E74-like factor 2
• ets family transcription factor ELF2C
• ETS-related transcription factor Elf-2
• NERF-1a
• NERF-1B
• NERF-2
• NERFEU32
• New ETS-related factor

Background

soform 1 transcriptionally activates the LYN and BLK promoters and acts synergistically with RUNX1 to transactivate the BLK promoter .Isoform 2 may function in repression of RUNX1-mediated transactivation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELF2