Home » Blk » Blk Antibodies » Blk Antibody (7A12)

Blk Antibody (7A12)

 (3 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Blk Antibody (7A12) [H00000640-M02] - Analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - Analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).Lane 2: ...read more
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in PC-12.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in Raw 264.7.
ELISA: Blk Antibody (7A12) [H00000640-M02] - Detection limit for recombinant GST tagged BLK is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, Flow, S-ELISA
Clone
7A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Blk Antibody (7A12) Summary

Immunogen
BLK (AAH07371, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
Localization
Nuclear
Specificity
BLK - B lymphoid tyrosine kinase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BLK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Flow Cytometry 1:10-1:1000
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. FACS usage was reported in scientific literature.
Reviewed Applications
Read 1 Review rated 4
using
H00000640-M02 in the following applications:
Publications
Read Publications using
H00000640-M02 in the following applications:

  • FLOW
    1 publication
  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Blk Antibody (7A12)

  • B lymphocyte kinase
  • B lymphoid tyrosine kinase
  • BLK nonreceptor tyrosine kinase
  • Blk
  • EC 2.7.10.2
  • MGC10442
  • MODY11
  • p55-Blk
  • tyrosine-protein kinase Blk

Background

The gene encoding BLK is a member of the SRC family of protooncogenes and shows preferential expression in B-lymphoid cells. It is thought to function in a signal transductory pathway specific to this lineage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lyn Antibody
[Unconjugated]
AF3206
Western blot shows lysates of U937 human histiocytic lymphoma cell line, PT18 mouse mast/basophil cell line, and Y3‑Ag rat myeloid cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Lyn at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, THP‑1 human acute monocytic leukemia cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Lyn at approximately 58-60 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Lyn was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with monensin using Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Fyn Antibody
(FYN-01)
NB500-517
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in murine transformed fibroblasts using anti-Fyn (FYN-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human primary fibroblasts using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human HeLa cell line using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Lck [p Tyr394]
Antibody (755103)
MAB7500
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and Ramos human Burkitt's lymphoma cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Phospho-Lck (Y394) Monoclonal Antibody (Catalog # MAB7500) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Phospho-Lck (Y394) at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Lck phosphorylated at Y394 was detected in immersion fixed Jurkat human acute T cell leukemia cells treated with (upper panel) or without (lower panel) Pervanadate using Mouse Anti-Human Phospho-Lck (Y394) Monoclonal Antibody (Catalog # MAB7500) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(5 Publications)
Species: Hu
Applications: WB, ICC
SYK Antibody
NBP1-32945
Western Blot: SYK Antibody [NBP1-32945] - SYK antibody detects SYK protein by western blot analysis. Whole cell extracts (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with SYK antibody at a dilution of 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SYK Antibody [NBP1-32945] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: SYK Antibody [NBP1-32945] - Paraffin-embedded rat spleen dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
STAT4 Antibody
(JJ08-85)
NBP2-67868
Western Blot: STAT4 Antibody (JJ08-85) [NBP2-67868] - Analysis of STAT4 on Daudi cells lysates using anti-STAT4 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: STAT4 Antibody (JJ08-85) [NBP2-67868] - Staining STAT4 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: STAT4 Antibody (JJ08-85) [NBP2-67868] - Analysis of paraffin-embedded human pancreas tissue using anti-STAT4 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Fgr Antibody (1B12)
H00002268-M03
Western Blot: Fgr Antibody (1B12) [H00002268-M03] - Analysis of FGR expression in transfected 293T cell line by FGR monoclonal antibody (M03), clone 1B12. Lane 1: FGR transfected lysatE (59.5 KDa). Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: Fgr Antibody (1B12) [H00002268-M03] - Analysis of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml
Western Blot: Fgr Antibody (1B12) [H00002268-M03] - Analysis of FGR expression in HeLa (Cat # L013V1).
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
IRF5 Antibody
NB100-1092
Western Blot: IRF5 Antibody [NB100-1092] - Western blot analysis of Human Spleen (A) and A549 cell lysate (B) + peptide (C), 35 ug protein in RIPA buffer. Antibody at 1 ug/mL. Detected by chemiluminescence
Western Blot: IRF5 Antibody [NB100-1092] - Endogenous IRF5 knockdown analysis. Ramos B cells were nucleofected with scrambled (Scr) or IRF5 (KD) siRNAs and lysates from same nucleofection run on multiple independent blots for comparative analysis of seven different commercially available alpha-IRF5 antibodies. Arrows indicate detection of an appropriately sized band(s) corresponding to IRF5. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep31002), licensed under a CC-BY licence.
Western Blot: IRF5 Antibody [NB100-1092] - Comparative analysis of IRF5 protein expression between immortalized lymphoid cell lines by immunoblot. Endogenous IRF5 protein expression in lysates (T, THP-1; R, Ramos B cells; J, Jurkat T cells) was detecting by running multiple independent blots for the analysis of antibody specificity; seven different commercially available alpha-IRF5 antibodies were evaluated. IRF5 expression was detected with the previously validated Cell Signaling antibody #3257 that is no longer available. beta-actin levels and apparent molecular weight standards are shown as loading controls and for size comparison, respectively. Arrows indicate detection of an appropriately sized band(s) corresponding to IRF5. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep31002), licensed under a CC-BY licence.
(9 Publications)
Species: Hu, Mu
Applications: WB, ChIP, Flow, PEP-ELISA
BTK [p Tyr223]
Antibody
NBP1-78295
Western Blot: BTK [p Tyr223] Antibody [NBP1-78295] - WB analysis of BTKpY223 on Ramos whole cell lysate with peptide competition: 1. ab only, 2. 200 molar excess unmodified immunizing peptide and 3. 200 molar excess modified immunizing peptide.
Immunohistochemistry: BTK [p Tyr223] Antibody [NBP1-78295] - IHC analysis of BTK in kidney cancer xenograft using DAB with hematoxylin counterstain.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Pax5/BSAP Antibody
NBP2-38790
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human duodenum shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Paraffin-embedded alcohol fixed rat spleen tissue (40x). Antigen retrieval pH9. PAX5 dilution 1:500 overnight at 4C. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Analysis in human lymph node and cerebral cortex tissues. Corresponding PAX5 RNA-seq data are presented for the same tissues.
(1 Review)
(1 Publication)
Species: Hu, Rt
Applications: IHC, IHC-P
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Western Blot: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of PYK2 on mouse brain lysates using anti-PYK2 antibody at 1:1000 dilution.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Analysis of paraffin-embedded mouse kidney tissue using anti-PYK2 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
BANK1 Antibody
NBP1-88714
Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human lymph node shows high expression.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
CD79A Antibody
(HM57)
NB100-64347
Immunohistochemistry: CD79A Antibody (HM57) [NB100-64347] - Paraffin-embedded alcohol fixed Rat Spleen tissue (20x). Antigen retrieval pH6. Dilution: 1:500 and ON incubation at 4C. This image was submitted via customer revies.
Flow Cytometry: CD79A Antibody (HM57) [NB100-64347] - Using the Allophycocyanin direct conjugate An intracellular stain was performed on Daudi cells with CD79A (HM 57) antibody NB100-64347APC (blue) and a matched isotype control NBP1-97005APC (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 0.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin.
Immunohistochemistry-Paraffin: CD79A Antibody (HM57) [NB100-64347] - Embedded human tonsil.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ma, Gt, Gp, Pm, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
HLA DQ Antibody
(SPV-L3)
NBP2-45041
Flow Cytometry: HLA DQ Antibody (SPV-L3) [NBP2-45041] - Flow Cytometric Analysis of Raji cells. HLA DQ Antibody (SPV-L3) followed by goat anti-Mouse IgG-CF488 (Blue); Isotype Control (Red).
(1 Publication)
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
Hck Antibody
(394903)
MAB3915
Western blot shows lysates of A20 mouse B cell lymphoma cell line, DA3 mouse myeloma cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Rat Anti-Human/Mouse Hck Monoclonal Antibody (Catalog # MAB3915) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for Hck at approximately 59 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
CD79B Antibody
(HM79-12)
NBP1-28140
Flow Cytometry: CD79B Antibody (HM79-12) [NBP1-28140] - Analysis using the PE conjugate of NBP1-28140. Staining of C57BL/6 splenocytes.
Flow Cytometry: CD79B Antibody (HM79-12) [NBP1-28140] - 1 ug/106 BALB/c splenocytes were incubated with either hamster IgG (as an isotype control) or purified hamster anti-mouse CD79, and then stained with mouse anti-hamster IgG (H+L)-FITC. Small lymphocytes were gated and analyzed on a flow cytometer
Flow Cytometry: CD79B Antibody (HM79-12) [NBP1-28140] - Analysis using the Biotin conjugate of NBP1-28140. Multiple staining of C57BL/6 splenocytes.
(3 Publications)
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - HCMV infection induces NOD2 mRNA and protein in HFFs and U373 cells. E. U373 glioma cells were infected with HCMV Towne strain and levels of NOD1, NOD2 and GAPDH mRNAs were measured by qRT-PCR at indicated time points. F. HFFs were infected with HCMV (Towne) at MOI of 1 PFU/cell and levels of NOD2 protein and B-actin were determined 48 and 72 hpi. G. HFFs were infected with HCMV (Towne) strain at MOI of 0.03 or 3 PFU/cell and levels of NOD2 protein and B-actin were determined at 48 hpi. Quantitative data represent mean values (+/-SD) of triplicate determinations from three independent experiments (*p<0.05, **p<0.01, ***p<0.001, one-way ANOVA test). Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pone.0092704.g001) licensed under a CC-BY licence.
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(20 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
A20/TNFAIP3
Antibody (59A426)
NBP1-77533
Western Blot: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - Human Jurkat lysate probed with A20 antibody at 4 ug/ml.
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on SK-MEL-28 cells with A20/TNFAIP3 (59A426) antibody NBP1-77533AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Simple Western: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - Lane view shows a specific band for A20/TNFAIP3 in 0.05 mg/ml of Jurkat lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(40 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for Blk Antibody (H00000640-M02)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: FLOW, WB.


Filter By Application
FLOW
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Review for Blk Antibody (H00000640-M02) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00000640-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Blk H00000640-M02
Enlarge 		4
reviewed by:
Anonymous
 WB Human 05/16/2011
View

Summary

ApplicationWestern Blot
Sample Tested100ng recombinant BLK, rLCK, rLYN, rFYN. 3ug Ramos whole cell lysate. 20ug Jurkat whole cell lysate.
SpeciesHuman
Lot6342-7A12-00AaY6
CommentsWe tested the monoclonal anti-BLK antibody, clone 7A12, in Western Blot for cross-reactivity to 3 other SRC family kinases (Lck, Lyn and Fyn) to determine if 7A12 cross-reacts with Lck in the same manner that the anti-BLK clones 9D10B7H6 and 9D10D1 do. 7A12 gave a positive band for rBLK (approximately 84kDa as expected), but not for rLCK, rLYN or rFYN. 7A12 also gave a positive band for Ramos, Jurkat, human thymus, CD4+ and CD8+ T cells (approximately 55kDa as expected).

Blocking

Blocking DetailsBlocking Buffer: LI-COR Blocking Buffer Catalogue #927-40000, Blocking Time: 1 hour, Blocking Temp: room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: PBST, Incubation Time: 12 hours, Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Infrared Dye 800CW goat anti-mouse, Secondary Ab Dilution Ratio: 1:10,000
Secondary Manufacturer Cat#92632210

Details

Detection NotesDetection Method: Odyssey Infrared Imaging System (LI-COR Biosciences, Lincoln, Nebraska)

Comments

CommentsWe tested the monoclonal anti-BLK antibody, clone 7A12, in Western Blot for cross-reactivity to 3 other SRC family kinases (Lck, Lyn and Fyn) to determine if 7A12 cross-reacts with Lck in the same manner that the anti-BLK clones 9D10B7H6 and 9D10D1 do. 7A12 gave a positive band for rBLK (approximately 84kDa as expected), but not for rLCK, rLYN or rFYN. 7A12 also gave a positive band for Ramos, Jurkat, human thymus, CD4+ and CD8+ T cells (approximately 55kDa as expected).

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blk Antibody (H00000640-M02). (Showing 1 - 1 of 1 FAQs).

  1. What is the concentration of H00000640-M02 Lot E9231-7A12?
    • The concentration of Lot# Lot E9231-7A12 is 0.5mg/mL.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Blk Products

Bioinformatics Tool for Blk Antibody (H00000640-M02)

Discover related pathways, diseases and genes to Blk Antibody (H00000640-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blk Antibody (H00000640-M02)

Discover more about diseases related to Blk Antibody (H00000640-M02).
 

Pathways for Blk Antibody (H00000640-M02)

View related products by pathway.

PTMs for Blk Antibody (H00000640-M02)

Learn more about PTMs related to Blk Antibody (H00000640-M02).
 

Research Areas for Blk Antibody (H00000640-M02)

Find related products by research area.

Blogs on Blk

There are no specific blogs for Blk, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot Blk H00000640-M02
Enlarge
 Anonymous
05/16/2011
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol BLK
Entrez
OMIM
Uniprot