Home » Blk » Blk Antibodies » Blk Antibody (7A12)

Blk Antibody (7A12)

 (3 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in Raw 264.7.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in Raw 264.7.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in PC-12.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - Analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).Lane 2: ...read more
ELISA: Blk Antibody (7A12) [H00000640-M02] - Detection limit for recombinant GST tagged BLK is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, Flow
Clone
7A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Blk Antibody (7A12) Summary

Immunogen
BLK (AAH07371, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
Localization
Nuclear
Specificity
BLK - B lymphoid tyrosine kinase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BLK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Flow Cytometry
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. FACS usage was reported in scientific literature.
Reviewed Applications
Read 1 Review rated 4
using
H00000640-M02 in the following applications:
Publications
Read Publications using
H00000640-M02 in the following applications:

  • FLOW
    1 publication
  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Blk Antibody (7A12)

  • B lymphocyte kinase
  • B lymphoid tyrosine kinase
  • BLK nonreceptor tyrosine kinase
  • Blk
  • EC 2.7.10.2
  • MGC10442
  • MODY11
  • p55-Blk
  • tyrosine-protein kinase Blk

Background

The gene encoding BLK is a member of the SRC family of protooncogenes and shows preferential expression in B-lymphoid cells. It is thought to function in a signal transductory pathway specific to this lineage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lyn Antibody
[Unconjugated]
AF3206
Western blot shows lysates of U937 human histiocytic lymphoma cell line, PT18 mouse mast/basophil cell line, and Y3‑Ag rat myeloid cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Lyn at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Lyn was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with monensin using Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, THP‑1 human acute monocytic leukemia cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Lyn at approximately 58-60 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Fyn Antibody
(FYN-01)
NB500-517
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in murine transformed fibroblasts using anti-Fyn (FYN-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human primary fibroblasts using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human HeLa cell line using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Lck [p Tyr394]
Antibody (755103)
MAB7500
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and Ramos human Burkitt's lymphoma cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Phospho-Lck (Y394) Monoclonal Antibody (Catalog # MAB7500) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Phospho-Lck (Y394) at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Lck phosphorylated at Y394 was detected in immersion fixed Jurkat human acute T cell leukemia cells treated with (upper panel) or without (lower panel) Pervanadate using Mouse Anti-Human Phospho-Lck (Y394) Monoclonal Antibody (Catalog # MAB7500) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(4 Publications)
Species: Hu
Applications: WB, ICC
SYK Antibody
NBP1-32945
Western Blot: SYK Antibody [NBP1-32945] - Mouse tissue extracts (50 ug) was separated by 7.5 % SDS-PAGE, and the membrane was blotted with SYK diluted by 1:1000.
Immunocytochemistry/Immunofluorescence: SYK Antibody [NBP1-32945] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: SYK Antibody [NBP1-32945] - Paraffin-embedded rat spleen dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
STAT4 Antibody
(JJ08-85)
NBP2-67868
Western Blot: STAT4 Antibody (JJ08-85) [NBP2-67868] - Analysis of STAT4 on Daudi cells lysates using anti-STAT4 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: STAT4 Antibody (JJ08-85) [NBP2-67868] - Staining STAT4 in SW480 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: STAT4 Antibody (JJ08-85) [NBP2-67868] - Analysis of paraffin-embedded human pancreas tissue using anti-STAT4 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Fgr Antibody
(349316)
MAB3207
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line, Raji human Burkitt's lymphoma cell line, Ramos human Burkitt's lymphoma cell line, and NRK rat normal kidney cell line. PVDF membrane was probed with 0.2 µg/mL of Human/Mouse/Rat Fgr Monoclonal Antibody (Catalog # MAB3207) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Fgr at approximately 59 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Species: Hu, Mu, Rt
Applications: WB
IRF5 Antibody
NB100-1092
Western Blot: IRF5 Antibody [NB100-1092] - Human Spleen (A) and Peripheral Blood Lymphocytes (B) lysates (RIPA buffer, 30 ug total protein per lane). Primary incubated for 1 hour. Detected by chemiluminescence
(9 Publications)
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
BTK [p Tyr223]
Antibody
NBP1-78295
Western Blot: BTK [p Tyr223] Antibody [NBP1-78295] - WB analysis of BTKpY223 on Ramos whole cell lysate with peptide competition: 1. ab only, 2. 200 molar excess unmodified immunizing peptide and 3. 200 molar excess modified immunizing peptide.
Immunohistochemistry: BTK [p Tyr223] Antibody [NBP1-78295] - IHC analysis of BTK in kidney cancer xenograft using DAB with hematoxylin counterstain.
(3 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Pax5/BSAP Antibody
NBP2-38790
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining in human lymph node and cerebral cortex tissues using anti-PAX5 antibody. Corresponding PAX5 RNA-seq data are presented for the same tissues.
Immunohistochemistry: Pax5/BSAP Antibody [NBP2-38790] - Paraffin-embedded alcohol fixed rat spleen tissue (40x). Antigen retrieval pH9. PAX5 dilution 1:500 ON at 4C. This image was submitted via customer review.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human cerebral cortex shows low expression as expected.
(1 Review)
Species: Hu
Applications: IHC, IHC-P
CTLA-4
7268-CT
CTLA-4
(2 Reviews)
(1 Publication)
Species: Hu
PYK2/FAK2 Antibody
NBP1-91228
Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Human breast cancer cell line MDA-MB-231 was treated with carboplatin for 72 hours and the expression of phospho-PYK2 and total PYK2 were detected by Western blot. Image from verified customer review.
Immunohistochemistry-Paraffin: PYK2/FAK2 Antibody [NBP1-91228] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
Western Blot: PYK2/FAK2 Antibody [NBP1-91228] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
(1 Review)
(1 Publication)
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
BANK1 Antibody
AF8005
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human BANK1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8005) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BANK1 at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
BCR Antibody
NBP1-19097
Immunocytochemistry/Immunofluorescence: BCR Antibody [NBP1-19097] - Human K562 cells (contains the chromosomal translocation, t(9:22) that creates the BCR/ABL fusion gene). Antibody used at a dilution of 1:1,000 (1ug/ml). Detection: Green-fluorescent goat anti-rabbit IgG - AlexaFluor 488 used at a dilution of 1:1,000.
Flow Cytometry: BCR Antibody [NBP1-19097] - Flow Cytometric Detection of BCR. 1 x 106 K562 cells were fixed, permeabilized, and stained with 0.25 mcg anti-BCR in a 150 mcl reaction. Isotype anti-KLH control (black), no antibody (red) and anti-BCR (blue).
Immunoprecipitation: BCR Antibody [NBP1-19097] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Affinity purified rabbit anti-BCR antibody used for IP at 10 mcg/mg lysate. BCR was also immunoprecipitated by rabbit anti-BCR antibody NBP1-19098, which recognizes a downstream epitope
Species: Hu
Applications: Flow, ICC/IF, IP
CD79A Antibody
(HM57)
NB100-64347
Immunohistochemistry: CD79A Antibody (HM57) [NB100-64347] - Paraffin-embedded alcohol fixed Rat Spleen tissue (20x). Antigen retrieval pH6. Dilution: 1:500 and ON incubation at 4C. This image was submitted via customer revies.
Flow Cytometry: CD79A Antibody (HM57) [NB100-64347] - Using the Allophycocyanin direct conjugate An intracellular stain was performed on Daudi cells with CD79A (HM 57) antibody NB100-64347APC (blue) and a matched isotype control NBP1-97005APC (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 0.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin.
Immunohistochemistry-Paraffin: CD79A Antibody (HM57) [NB100-64347] - Embedded human tonsil.
(2 Reviews)
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
HLA DQA1 Antibody
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human lung shows high expression.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, IHC, IHC-P
Hck Antibody
(394903)
MAB3915
Western blot shows lysates of A20 mouse B cell lymphoma cell line, DA3 mouse myeloma cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Rat Anti-Human/Mouse Hck Monoclonal Antibody (Catalog # MAB3915) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for Hck at approximately 59 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
CD79B Antibody
(HM79-12)
NBP1-28140
Flow Cytometry: CD79B Antibody (HM79-12) [NBP1-28140] - Analysis using the PE conjugate of NBP1-28140. Staining of C57BL/6 splenocytes.
Flow Cytometry: CD79B Antibody (HM79-12) [NBP1-28140] - 1 ug/106 BALB/c splenocytes were incubated with either hamster IgG (as an isotype control) or purified hamster anti-mouse CD79, and then stained with mouse anti-hamster IgG (H+L)-FITC. Small lymphocytes were gated and analyzed on a flow cytometer
Flow Cytometry: CD79B Antibody (HM79-12) [NBP1-28140] - Analysis using the Biotin conjugate of NBP1-28140. Multiple staining of C57BL/6 splenocytes.
(4 Publications)
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(13 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
A20/TNFAIP3
Antibody (59A426)
NBP1-77533
Western Blot: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - Human Jurkat lysate probed with A20 antibody at 4 ug/ml.
Immunohistochemistry-Paraffin: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - Human placenta probed with A20 antibody at 5 ug/ml, cytoplasmic staining of decidual cells is observed. Human tissue TMA was used for this test. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on HeLa cells with A20/TNFAIP3 (59A426) antibody NBP1-77533F (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to FITC.
(38 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready

Publications for Blk Antibody (H00000640-M02)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: FLOW, WB.


Filter By Application
FLOW
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Review for Blk Antibody (H00000640-M02) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00000640-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Blk H00000640-M02
Enlarge
reviewed by:
Anonymous
 WB Human 05/16/2011
View

Summary

ApplicationWestern Blot
Sample Tested100ng recombinant BLK, rLCK, rLYN, rFYN. 3ug Ramos whole cell lysate. 20ug Jurkat whole cell lysate.
SpeciesHuman
Lot6342-7A12-00AaY6
CommentsWe tested the monoclonal anti-BLK antibody, clone 7A12, in Western Blot for cross-reactivity to 3 other SRC family kinases (Lck, Lyn and Fyn) to determine if 7A12 cross-reacts with Lck in the same manner that the anti-BLK clones 9D10B7H6 and 9D10D1 do. 7A12 gave a positive band for rBLK (approximately 84kDa as expected), but not for rLCK, rLYN or rFYN. 7A12 also gave a positive band for Ramos, Jurkat, human thymus, CD4+ and CD8+ T cells (approximately 55kDa as expected).

Blocking

Blocking DetailsBlocking Buffer: LI-COR Blocking Buffer Catalogue #927-40000, Blocking Time: 1 hour, Blocking Temp: room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: PBST, Incubation Time: 12 hours, Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Infrared Dye 800CW goat anti-mouse, Secondary Ab Dilution Ratio: 1:10,000
Secondary Manufacturer Cat#92632210

Details

Detection NotesDetection Method: Odyssey Infrared Imaging System (LI-COR Biosciences, Lincoln, Nebraska)

Comments

CommentsWe tested the monoclonal anti-BLK antibody, clone 7A12, in Western Blot for cross-reactivity to 3 other SRC family kinases (Lck, Lyn and Fyn) to determine if 7A12 cross-reacts with Lck in the same manner that the anti-BLK clones 9D10B7H6 and 9D10D1 do. 7A12 gave a positive band for rBLK (approximately 84kDa as expected), but not for rLCK, rLYN or rFYN. 7A12 also gave a positive band for Ramos, Jurkat, human thymus, CD4+ and CD8+ T cells (approximately 55kDa as expected).

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blk Antibody (H00000640-M02). (Showing 1 - 1 of 1 FAQs).

  1. What is the concentration of H00000640-M02 Lot E9231-7A12?
    • The concentration of Lot# Lot E9231-7A12 is 0.5mg/mL.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Blk Antibody (H00000640-M02)

Discover related pathways, diseases and genes to Blk Antibody (H00000640-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blk Antibody (H00000640-M02)

Discover more about diseases related to Blk Antibody (H00000640-M02).
 

Pathways for Blk Antibody (H00000640-M02)

View related products by pathway.

PTMs for Blk Antibody (H00000640-M02)

Learn more about PTMs related to Blk Antibody (H00000640-M02).
 

Research Areas for Blk Antibody (H00000640-M02)

Find related products by research area.

Blogs on Blk

There are no specific blogs for Blk, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot Blk H00000640-M02
Enlarge
 Anonymous
05/16/2011
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol BLK
Entrez
OMIM
Uniprot