Blk Antibody (7A12)

Images

 
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in Raw 264.7.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in PC-12.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - Analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).Lane 2: ...read more
Sandwich ELISA: Blk Antibody (7A12) [H00000640-M02] - Detection limit for recombinant GST tagged BLK is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, Flow
Clone
7A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Blk Antibody (7A12) Summary

Immunogen
BLK (AAH07371, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
Localization
Nuclear
Specificity
BLK - B lymphoid tyrosine kinase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BLK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Flow Cytometry
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. FACS usage was reported in scientific literature.
Reviewed Applications
Read 1 Review rated 4
using
H00000640-M02 in the following applications:

Publications
Read Publications using
H00000640-M02 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Blk Antibody (7A12)

  • B lymphocyte kinase
  • B lymphoid tyrosine kinase
  • BLK nonreceptor tyrosine kinase
  • Blk
  • EC 2.7.10.2
  • MGC10442
  • MODY11
  • p55-Blk
  • tyrosine-protein kinase Blk

Background

The gene encoding BLK is a member of the SRC family of protooncogenes and shows preferential expression in B-lymphoid cells. It is thought to function in a signal transductory pathway specific to this lineage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB3207
Species: Hu, Mu, Rt
Applications: WB
NB100-1092
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8005
Species: Hu
Applications: WB
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
MAB3915
Species: Hu, Mu
Applications: WB
NBP1-28140
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready

Publications for Blk Antibody (H00000640-M02)(3)

Review for Blk Antibody (H00000640-M02) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00000640-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Blk H00000640-M02
Enlarge
reviewed by:
Anonymous
WB Human 05/16/2011
View

Summary

ApplicationWestern Blot
Sample Tested100ng recombinant BLK, rLCK, rLYN, rFYN. 3ug Ramos whole cell lysate. 20ug Jurkat whole cell lysate.
SpeciesHuman
Lot6342-7A12-00AaY6
CommentsWe tested the monoclonal anti-BLK antibody, clone 7A12, in Western Blot for cross-reactivity to 3 other SRC family kinases (Lck, Lyn and Fyn) to determine if 7A12 cross-reacts with Lck in the same manner that the anti-BLK clones 9D10B7H6 and 9D10D1 do. 7A12 gave a positive band for rBLK (approximately 84kDa as expected), but not for rLCK, rLYN or rFYN. 7A12 also gave a positive band for Ramos, Jurkat, human thymus, CD4+ and CD8+ T cells (approximately 55kDa as expected).

Blocking

Blocking DetailsBlocking Buffer: LI-COR Blocking Buffer Catalogue #927-40000, Blocking Time: 1 hour, Blocking Temp: room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: PBST, Incubation Time: 12 hours, Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Infrared Dye 800CW goat anti-mouse, Secondary Ab Dilution Ratio: 1:10,000
Secondary Manufacturer Cat#92632210

Details

Detection NotesDetection Method: Odyssey Infrared Imaging System (LI-COR Biosciences, Lincoln, Nebraska)

Comments

CommentsWe tested the monoclonal anti-BLK antibody, clone 7A12, in Western Blot for cross-reactivity to 3 other SRC family kinases (Lck, Lyn and Fyn) to determine if 7A12 cross-reacts with Lck in the same manner that the anti-BLK clones 9D10B7H6 and 9D10D1 do. 7A12 gave a positive band for rBLK (approximately 84kDa as expected), but not for rLCK, rLYN or rFYN. 7A12 also gave a positive band for Ramos, Jurkat, human thymus, CD4+ and CD8+ T cells (approximately 55kDa as expected).

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blk Antibody (H00000640-M02). (Showing 1 - 1 of 1 FAQs).

  1. What is the concentration of H00000640-M02 Lot E9231-7A12?
    • The concentration of Lot# Lot E9231-7A12 is 0.5mg/mL.

Secondary Antibodies

 

Isotype Controls

Additional Blk Products

Bioinformatics Tool for Blk Antibody (H00000640-M02)

Discover related pathways, diseases and genes to Blk Antibody (H00000640-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blk Antibody (H00000640-M02)

Discover more about diseases related to Blk Antibody (H00000640-M02).
 

Pathways for Blk Antibody (H00000640-M02)

View related products by pathway.

PTMs for Blk Antibody (H00000640-M02)

Learn more about PTMs related to Blk Antibody (H00000640-M02).
 

Research Areas for Blk Antibody (H00000640-M02)

Find related products by research area.

Blogs on Blk

There are no specific blogs for Blk, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
05/16/2011
Application: WB
Species: Human

Bioinformatics

Gene Symbol BLK
Entrez
OMIM
Uniprot