Home » Blk » Blk Antibodies » Blk Antibody (7A12)

Blk Antibody (7A12)

 (3 Publications)
 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Blk Antibody (7A12) [H00000640-M02] - Analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).Lane 2: Non-transfected lysate.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - Analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12.Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa).Lane 2: ...read more
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in PC-12.
Western Blot: Blk Antibody (7A12) [H00000640-M02] - BLK monoclonal antibody (M02), clone 7A12. Analysis of BLK expression in Raw 264.7.
ELISA: Blk Antibody (7A12) [H00000640-M02] - Detection limit for recombinant GST tagged BLK is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, Flow
Clone
7A12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Blk Antibody (7A12) Summary

Immunogen
BLK (AAH07371, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
Localization
Nuclear
Specificity
BLK - B lymphoid tyrosine kinase
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BLK
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Flow Cytometry 1:10-1:1000
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA. FACS usage was reported in scientific literature.
Reviewed Applications
Read 1 Review rated 4
using
H00000640-M02 in the following applications:
Publications
Read Publications using
H00000640-M02 in the following applications:

  • FLOW
    1 publication
  • WB
    1 publication

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Blk Antibody (7A12)

  • B lymphocyte kinase
  • B lymphoid tyrosine kinase
  • BLK nonreceptor tyrosine kinase
  • Blk
  • EC 2.7.10.2
  • MGC10442
  • MODY11
  • p55-Blk
  • tyrosine-protein kinase Blk

Background

The gene encoding BLK is a member of the SRC family of protooncogenes and shows preferential expression in B-lymphoid cells. It is thought to function in a signal transductory pathway specific to this lineage.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lyn Antibody
[Unconjugated]
AF3206
Western blot shows lysates of U937 human histiocytic lymphoma cell line, PT18 mouse mast/basophil cell line, and Y3‑Ag rat myeloid cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Lyn at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of Nalm‑6 human Pre-B acute lymphocytic leukemia cell line, THP‑1 human acute monocytic leukemia cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for Lyn at approximately 58-60 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Lyn was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with monensin using Goat Anti-Human/Mouse/Rat Lyn Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3206) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Fyn Antibody
(FYN-01) - BSA Free
NB500-517
Immunoprecipitation: Fyn Antibody (FYN-01) [NB500-517] - Immunoprecipitation of Fyn from the lysate of T cells isolated from fresh buffy coats. Western blot was immunostained with anti-Fyn (FYN-01). Lane 1: original lysate of T cells Lane 2-3: Immunoprecipitated material eluted from affinity sorbent (FYN-01 coupled to Sepharose beads). Lanes differ in amount of T cell lysate loaded on the immunosorbent.
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human primary fibroblasts using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human HeLa cell line using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Lck [p Tyr394]
Antibody (755103)
MAB7500
Lck phosphorylated at Y394 was detected in immersion fixed Jurkat human acute T cell leukemia cells treated with (upper panel) or without (lower panel) Pervanadate using Mouse Anti-Human Phospho-Lck (Y394) Monoclonal Antibody (Catalog # MAB7500) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Western blot shows lysates of Jurkat human acute T cell leukemia cell line and Ramos human Burkitt's lymphoma cell line untreated (-) or treated (+) with 1 mM Pervanadate (PV) for 5 minutes. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human Phospho-Lck (Y394) Monoclonal Antibody (Catalog # MAB7500) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Phospho-Lck (Y394) at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(7 Publications)
Species: Hu
Applications: ICC, WB
SYK Antibody
NBP1-32945
Western Blot: SYK Antibody [NBP1-32945] - SYK antibody detects SYK protein by western blot analysis. Whole cell extracts (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with SYK antibody at a dilution of 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: SYK Antibody [NBP1-32945] - SYK antibody detects SYK protein by western blot analysis. Whole cell extracts (30 ug) was separated by 7.5% SDS-PAGE, and the membrane was blotted with SYK antibody at a dilution of 1:2000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunoprecipitation: SYK Antibody [NBP1-32945] - Immunoprecipitation of SYK protein from A431 whole cell extracts using 5 ug of SYK antibody. Western blot analysis was performed using SYK antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
STAT4 Antibody
(JJ08-85)
NBP2-67868
Flow Cytometry: STAT4 Antibody (JJ08-85) [NBP2-67868] - Analysis of Hela cells with STAT4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: STAT4 Antibody (JJ08-85) [NBP2-67868] - Staining STAT4 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: STAT4 Antibody (JJ08-85) [NBP2-67868] - Staining STAT4 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Fgr Antibody
NBP1-85677
Immunohistochemistry-Paraffin: Fgr Antibody [NBP1-85677] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Fgr Antibody [NBP1-85677] - Analysis in human bone marrow and skeletal muscle tissues using NBP1-85677 antibody. Corresponding FGR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Fgr Antibody [NBP1-85677] - Staining of human Bone marrow shows strong cytoplasmic and membranous positivity in hematopoietic cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IRF5 Antibody
NB100-1092
Western Blot: IRF5 Antibody [NB100-1092] - Endogenous IRF5 knockdown analysis. Ramos B cells were nucleofected with scrambled (Scr) or IRF5 (KD) siRNAs and lysates from same nucleofection run on multiple independent blots for comparative analysis of seven different commercially available alpha-IRF5 antibodies. Arrows indicate detection of an appropriately sized band(s) corresponding to IRF5. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep31002), licensed under a CC-BY licence.
Western Blot: IRF5 Antibody [NB100-1092] - Comparative analysis of IRF5 protein expression between immortalized lymphoid cell lines by immunoblot. Endogenous IRF5 protein expression in lysates (T, THP-1; R, Ramos B cells; J, Jurkat T cells) was detecting by running multiple independent blots for the analysis of antibody specificity; seven different commercially available alpha-IRF5 antibodies were evaluated. IRF5 expression was detected with the previously validated Cell Signaling antibody #3257 that is no longer available. beta-actin levels and apparent molecular weight standards are shown as loading controls and for size comparison, respectively. Arrows indicate detection of an appropriately sized band(s) corresponding to IRF5. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep31002), licensed under a CC-BY licence.
Western Blot: IRF5 Antibody [NB100-1092] - Western blot analysis of Human Spleen (A) and A549 cell lysate (B) + peptide (C), 35 ug protein in RIPA buffer. Antibody at 1 ug/mL. Detected by chemiluminescence
(9 Publications)
Species: Hu, Mu
Applications: ChIP, Flow, PEP-ELISA, WB
BTK [p Tyr223]
Antibody - BSA Free
NBP1-78295
Immunohistochemistry: BTK [p Tyr223] Antibody [NBP1-78295] - IHC analysis of BTK in kidney cancer xenograft using DAB with hematoxylin counterstain.
Western Blot: BTK [p Tyr223] Antibody [NBP1-78295] - WB analysis of BTKpY223 on Ramos whole cell lysate with peptide competition: 1. ab only, 2. 200 molar excess unmodified immunizing peptide and 3. 200 molar excess modified immunizing peptide.
(3 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Pax5/BSAP Antibody
NBP2-38790
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Analysis in human lymph node and cerebral cortex tissues. Corresponding PAX5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human tonsil shows strong nuclear positivity in germinal center cells.
Immunohistochemistry-Paraffin: Pax5/BSAP Antibody [NBP2-38790] - Staining of human cerebral cortex shows no positivity in neurons as expected.
(1 Review)
(3 Publications)
Species: Ha, Hu, Rt
Applications: IHC, IHC-P
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(2 Publications)
Species: Hu
Applications: BA
PYK2/FAK2 Antibody
(SC06-15)
NBP2-67627
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
Immunocytochemistry/Immunofluorescence: PYK2/FAK2 Antibody (SC06-15) [NBP2-67627] - Staining PYK2 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilized with 0.25% Triton X-100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
BANK1 Antibody
NBP1-88714
Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining in human lymph node and cerebral cortex tissues using anti-BANK1 antibody. Corresponding BANK1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
BCR Antibody
AF5129
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, K562 human chronic myelogenous leukemia cell line, and MCF‑7 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Human BCR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5129) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for BCR at approximately 155 - 165 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: WB
CD79A Antibody
(HM57) - BSA Free
NB100-64347
Flow Cytometry: CD79A Antibody (HM57) [NB100-64347] - Using the Allophycocyanin direct conjugate An intracellular stain was performed on Daudi cells with CD79A (HM 57) antibody NB100-64347APC (blue) and a matched isotype control NBP1-97005APC (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 0.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin.
Immunohistochemistry: CD79A Antibody (HM57) [NB100-64347] - Paraffin-embedded alcohol fixed Rat Spleen tissue (20x). Antigen retrieval pH6. Dilution: 1:500 and ON incubation at 4C. This image was submitted via customer revies.
Immunohistochemistry-Paraffin: CD79A Antibody (HM57) [NB100-64347] - Embedded human tonsil.
(2 Reviews)
(2 Publications)
Species: Bv, Ca, Ch, Eq, Ma, Gt, Gp, Hu, Pm, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.
Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).
Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Hck Antibody
(394903)
MAB3915
Western blot shows lysates of A20 mouse B cell lymphoma cell line, DA3 mouse myeloma cell line, Raji human Burkitt's lymphoma cell line, and Ramos human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Rat Anti-Human/Mouse Hck Monoclonal Antibody (Catalog # MAB3915) followed by HRP-conjugated Anti-Rat IgG Secondary Antibody (Catalog # HAF005). A specific band was detected for Hck at approximately 59 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu
Applications: WB
CD79B Antibody
AF6814
Western blot shows lysates of mouse lymph node tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse CD79B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6814) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for CD79B at approximately 38 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Mouse splenocytes were stained with Sheep Anti-Mouse CD79B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6814) followed by Allophycocyanin-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # F0127) and Rat Anti-Mouse B220/CD45R PE-conjugated Monoclonal Antibody (Catalog # FAB1217P). Quadrant markers were set based on control antibody staining (Catalog # 5-001-A).
CD79B was detected in immersion fixed mouse splenocytes using Sheep Anti-Mouse CD79B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6814) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to cell surfaces and cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(23 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
A20/TNFAIP3
Antibody (59A426) - B ...
NBP1-77533
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on SK-MEL-28 cells with A20/TNFAIP3 (59A426) antibody NBP1-77533AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - HepG2 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-A20/TNFAIP3 (59A426) at 10 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective
Flow Cytometry: A20/TNFAIP3 Antibody (59A426) [NBP1-77533] - An intracellular stain was performed on RH-30 cells with A20/TNFAIP3 Antibody (59A426) NBP1-77533PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(42 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Publications for Blk Antibody (H00000640-M02)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: FLOW, WB.


Filter By Application
FLOW
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Review for Blk Antibody (H00000640-M02) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00000640-M02:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Blk H00000640-M02
Enlarge 		4
reviewed by:
Verified Customer
 WB Human 05/16/2011
View

Summary

ApplicationWestern Blot
Sample Tested100ng recombinant BLK, rLCK, rLYN, rFYN. 3ug Ramos whole cell lysate. 20ug Jurkat whole cell lysate.
SpeciesHuman
Lot6342-7A12-00AaY6
CommentsWe tested the monoclonal anti-BLK antibody, clone 7A12, in Western Blot for cross-reactivity to 3 other SRC family kinases (Lck, Lyn and Fyn) to determine if 7A12 cross-reacts with Lck in the same manner that the anti-BLK clones 9D10B7H6 and 9D10D1 do. 7A12 gave a positive band for rBLK (approximately 84kDa as expected), but not for rLCK, rLYN or rFYN. 7A12 also gave a positive band for Ramos, Jurkat, human thymus, CD4+ and CD8+ T cells (approximately 55kDa as expected).

Blocking

Blocking DetailsBlocking Buffer: LI-COR Blocking Buffer Catalogue #927-40000, Blocking Time: 1 hour, Blocking Temp: room temperature

Primary Anitbody

Dilution RatioDilution Ratio: 1:500, Incubation Dilution Buffer: PBST, Incubation Time: 12 hours, Incubation Temp: 4 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Infrared Dye 800CW goat anti-mouse, Secondary Ab Dilution Ratio: 1:10,000
Secondary Manufacturer Cat#92632210

Details

Detection NotesDetection Method: Odyssey Infrared Imaging System (LI-COR Biosciences, Lincoln, Nebraska)

Comments

CommentsWe tested the monoclonal anti-BLK antibody, clone 7A12, in Western Blot for cross-reactivity to 3 other SRC family kinases (Lck, Lyn and Fyn) to determine if 7A12 cross-reacts with Lck in the same manner that the anti-BLK clones 9D10B7H6 and 9D10D1 do. 7A12 gave a positive band for rBLK (approximately 84kDa as expected), but not for rLCK, rLYN or rFYN. 7A12 also gave a positive band for Ramos, Jurkat, human thymus, CD4+ and CD8+ T cells (approximately 55kDa as expected).

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Blk Antibody (H00000640-M02). (Showing 1 - 1 of 1 FAQs).

  1. What is the concentration of H00000640-M02 Lot E9231-7A12?
    • The concentration of Lot# Lot E9231-7A12 is 0.5mg/mL.

Secondary Antibodies

 

Isotype Controls

Additional Blk Products

Bioinformatics Tool for Blk Antibody (H00000640-M02)

Discover related pathways, diseases and genes to Blk Antibody (H00000640-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Blk Antibody (H00000640-M02)

Discover more about diseases related to Blk Antibody (H00000640-M02).
 

Pathways for Blk Antibody (H00000640-M02)

View related products by pathway.

PTMs for Blk Antibody (H00000640-M02)

Learn more about PTMs related to Blk Antibody (H00000640-M02).
 

Research Areas for Blk Antibody (H00000640-M02)

Find related products by research area.

Blogs on Blk

There are no specific blogs for Blk, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot Blk H00000640-M02
Enlarge
 Verified Customer
05/16/2011
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol BLK
Entrez
OMIM
Uniprot