SPDEF Antibody

Images

 
Western Blot: SPDEF Antibody [NBP3-04686] - Analysis of extracts of rat ovary, using SPDEF antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per ...read more
Immunocytochemistry/ Immunofluorescence: SPDEF Antibody [NBP3-04686] - Analysis of MCF7 cells using SPDEF antibody .
Immunohistochemistry-Paraffin: SPDEF Antibody [NBP3-04686] - Human placenta using SPDEF antibody at dilution of 1:100 (40x lens).

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPDEF Antibody Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-335 of human SPDEF (NP_036523.1). MGSASPGLSSVSPSHLLLPPDTVSRTGLEKAAAGAVGLERRDWSPSPPATPEQGLSAFYLSYFDMLYPEDSSWAAKAPGASSREEPPEEPEQCPVIDSQAPAGSLDLVPGGLTLEEHSLEQVQSMVVGEVLKDIETACKLLNITADPMDWSPSNVQKWLLWTEHQYRLPPMGKAFQELAGKELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTSEESWTDSEVDSSCSGQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLVYQFVHPI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPDEF
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:1000
Publications
Read Publication using NBP3-04686.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SPDEF Antibody

  • bA375E1.3
  • PDEFRP11-375E1__A.3
  • Prostate epithelium-specific Ets transcription factor
  • Prostate-derived Ets factor
  • Prostate-specific Ets
  • PSE
  • SAM pointed domain containing ets transcription factor
  • SAM pointed domain-containing Ets transcription factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DKK300
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24677
Species: Ca, Eq, Hu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
M1300CB
Species: Mu
Applications: ELISA
NBP2-75729
Species: Hu
Applications: IHC, IHC-P, PA, WB
NBP2-88319
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87780
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB500-201
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
1310-SE
Species: Hu
Applications: EnzAct
NBP2-57713
Species: Hu
Applications: ICC/IF, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P

Publications for SPDEF Antibody (NBP3-04686)(1)

Reviews for SPDEF Antibody (NBP3-04686) (0)

There are no reviews for SPDEF Antibody (NBP3-04686). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPDEF Antibody (NBP3-04686) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPDEF Products

Bioinformatics Tool for SPDEF Antibody (NBP3-04686)

Discover related pathways, diseases and genes to SPDEF Antibody (NBP3-04686). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPDEF Antibody (NBP3-04686)

Discover more about diseases related to SPDEF Antibody (NBP3-04686).
 

Pathways for SPDEF Antibody (NBP3-04686)

View related products by pathway.

PTMs for SPDEF Antibody (NBP3-04686)

Learn more about PTMs related to SPDEF Antibody (NBP3-04686).
 

Research Areas for SPDEF Antibody (NBP3-04686)

Find related products by research area.

Blogs on SPDEF

There are no specific blogs for SPDEF, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPDEF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPDEF