Elf4/MEF Antibody


Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human stomach shows high expression.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human colon shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Elf4/MEF Antibody [NBP2-33286] - Staining in human stomach and cerebral cortex tissues using anti-ELF4 antibody. Corresponding ELF4 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

Elf4/MEF Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SSRVSSRSAPQGKGSSSWEKPKIQHVGLQPSASLELGPSLDEEIPTTSTMLVSPAEGQVKLTKAVSASSVPSNIHLGVA
Specificity of human Elf4/MEF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Elf4/MEF Protein (NBP2-33286PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Elf4/MEF Antibody

  • E74-like factor 4 (ets domain transcription factor)
  • E74-like factor 4
  • ETS-related transcription factor Elf-4
  • MEFELFRMyeloid Elf-1-like factor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Elf4/MEF Antibody (NBP2-33286) (0)

There are no publications for Elf4/MEF Antibody (NBP2-33286).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Elf4/MEF Antibody (NBP2-33286) (0)

There are no reviews for Elf4/MEF Antibody (NBP2-33286). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Elf4/MEF Antibody (NBP2-33286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Elf4/MEF Products

Bioinformatics Tool for Elf4/MEF Antibody (NBP2-33286)

Discover related pathways, diseases and genes to Elf4/MEF Antibody (NBP2-33286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Elf4/MEF Antibody (NBP2-33286)

Discover more about diseases related to Elf4/MEF Antibody (NBP2-33286).

Pathways for Elf4/MEF Antibody (NBP2-33286)

View related products by pathway.

PTMs for Elf4/MEF Antibody (NBP2-33286)

Learn more about PTMs related to Elf4/MEF Antibody (NBP2-33286).

Research Areas for Elf4/MEF Antibody (NBP2-33286)

Find related products by research area.

Blogs on Elf4/MEF

There are no specific blogs for Elf4/MEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Elf4/MEF Antibody and receive a gift card or discount.


Gene Symbol ELF4