E74 like factor 1 Antibody - BSA Free

Western Blot: E74 like factor 1 Antibody [NBP1-90352] - Analysis in human cell line HEL.

Immunohistochemistry-Paraffin: E74 like factor 1 Antibody [NBP1-90352] - Staining of human lymph node shows distinct nuclear positivity in germinal center cells.

Western Blot: E74 like factor 1 Antibody [NBP1-90352] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

E74 like factor 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRTIQAPTQVPVVVSPRNQQL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  E74 like factor 1 Protein (NBP1-90352PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for E74 like factor 1 Antibody - BSA Free

• E74-like factor 1 (ets domain transcription factor)
• E74-like factor 1
• ETS-related transcription factor Elf-1

Background

E74-like factor 1 (ELF1) is a member of the ETS (e26 transformation specific sequence) family of proteins, contains an ETS-domain, and shares sequence identity with the Drosophila ecdysone inducible E74 transcription factor. ETS was originally identified in the E26 retroviral isolate that led to the discovery of c-ets-1 (cellular ets-1), a cellular oncogenic transcription factor capable of transforming cells. Like ETS, ELF-1 functions as a transcription factor and has been shown to bind promoter and enhancer elements in a number of immunity responsive genes. ELF-1 is highly expressed in B-cells and appears to play an integral role in B-cell gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELF1