E74 like factor 1 Antibody

Images

 
Western Blot: E74 like factor 1 Antibody [NBP1-90352] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: ...read more
Immunocytochemistry/ Immunofluorescence: E74 like factor 1 Antibody [NBP1-90352] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: E74 like factor 1 Antibody [NBP1-90352] - Staining of human lymph node shows distinct nuclear positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

E74 like factor 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSSSIESSDPSLSSSATSNRNQTSRSRVSSSPGVKGGATTVLKPGNSKAAKPKDPVEVAQPSEVLRTVQPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDETLNSSVQSIRTIQAPTQVPVVVSPRNQQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
E74 like factor 1 Protein (NBP1-90352PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for E74 like factor 1 Antibody

  • E74-like factor 1 (ets domain transcription factor)
  • E74-like factor 1
  • ETS-related transcription factor Elf-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF603
Species: Mu
Applications: WB, Block, ICC
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84770
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-14951
Species: Hu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for E74 like factor 1 Antibody (NBP1-90352) (0)

There are no publications for E74 like factor 1 Antibody (NBP1-90352).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for E74 like factor 1 Antibody (NBP1-90352) (0)

There are no reviews for E74 like factor 1 Antibody (NBP1-90352). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for E74 like factor 1 Antibody (NBP1-90352) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional E74 like factor 1 Products

Bioinformatics Tool for E74 like factor 1 Antibody (NBP1-90352)

Discover related pathways, diseases and genes to E74 like factor 1 Antibody (NBP1-90352). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E74 like factor 1 Antibody (NBP1-90352)

Discover more about diseases related to E74 like factor 1 Antibody (NBP1-90352).
 

Pathways for E74 like factor 1 Antibody (NBP1-90352)

View related products by pathway.

PTMs for E74 like factor 1 Antibody (NBP1-90352)

Learn more about PTMs related to E74 like factor 1 Antibody (NBP1-90352).
 

Research Areas for E74 like factor 1 Antibody (NBP1-90352)

Find related products by research area.

Blogs on E74 like factor 1

There are no specific blogs for E74 like factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our E74 like factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELF1