eIF4E Antibody


Western Blot: eIF4E Antibody [NBP2-57098] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: eIF4E Antibody [NBP2-57098] - Staining of human cell line U-2 OS shows localization to cytosol & cytoplasmic bodies. Antibody staining is shown in green.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

eIF4E Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP
Specificity of human eIF4E antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for eIF4E Antibody

  • CBP
  • eIF4E
  • eIF-4E
  • EIF4E1
  • EIF4EL1
  • EIF4EL1MGC111573
  • eIF-4F 25 kDa subunit
  • EIF4F
  • eukaryotic translation initiation factor 4E
  • eukaryotic translation initiation factor 4E-like 1
  • mRNA cap-binding protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu
Applications: WB, ChIP, IP
Species: Hu
Applications: WB, IHC, IHC-P, KO
Species: Hu, Po
Applications: WB, IP
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P

Publications for eIF4E Antibody (NBP2-57098) (0)

There are no publications for eIF4E Antibody (NBP2-57098).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4E Antibody (NBP2-57098) (0)

There are no reviews for eIF4E Antibody (NBP2-57098). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eIF4E Antibody (NBP2-57098) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional eIF4E Products

Bioinformatics Tool for eIF4E Antibody (NBP2-57098)

Discover related pathways, diseases and genes to eIF4E Antibody (NBP2-57098). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4E Antibody (NBP2-57098)

Discover more about diseases related to eIF4E Antibody (NBP2-57098).

Pathways for eIF4E Antibody (NBP2-57098)

View related products by pathway.

PTMs for eIF4E Antibody (NBP2-57098)

Learn more about PTMs related to eIF4E Antibody (NBP2-57098).

Research Areas for eIF4E Antibody (NBP2-57098)

Find related products by research area.

Blogs on eIF4E

There are no specific blogs for eIF4E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our eIF4E Antibody and receive a gift card or discount.


Gene Symbol EIF4E