eIF4E Antibody - BSA Free

Western Blot: eIF4E Antibody [NBP2-57098] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: eIF4E Antibody [NBP2-57098] - Staining of human cell line U-2 OS shows localization to cytosol & cytoplasmic bodies. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

eIF4E Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHP
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF4E
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  eIF4E Recombinant Protein Antigen (NBP2-57098PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for eIF4E Antibody - BSA Free

• CBP
• eIF4E
• eIF-4E
• EIF4E1
• EIF4EL1
• EIF4EL1MGC111573
• eIF-4F 25 kDa subunit
• EIF4F
• eukaryotic translation initiation factor 4E
• eukaryotic translation initiation factor 4E-like 1
• mRNA cap-binding protein

Background

eIF-4E is a eukaryotic translation initiation factor involved in directing ribosomes to the cap structure of mRNAs. It exists in two forms: as a free form (25 kDa) and as part of a multiprotein complex eIF-4F (1). eIF-4E appears to be the least abundant of the initiation factors and acts as a rate-limiting step of initiation (2). Since translation is regulated by phosphorylation, eIF-4E phosphorylation at Ser 209 by MAPK signal-integrating kinase 1 (Mnk1) and kinase 2 (Mnk2) may directly regulate the rate of protein synthesis initiation (3). There is also evidence that eIF-4E can function as an oncogene (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF4E