eIF4A2 Antibody - BSA Free

Western Blot: eIF4A2 Antibody [NBP2-87347] - Host: Rabbit. Target Name: EIF4A2. Sample Tissue: Mouse Heart lysates. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

eIF4A2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse eIF4A2. Peptide sequence: GSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF4A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for eIF4A2 Antibody - BSA Free

• ATP-dependent RNA helicase eIF4A-2
• BM-010
• DDX2Beukaryotic translation initiation factor 4A, isoform 2
• EC 3.6.1
• EC 3.6.4.13
• EIF4A
• eIF-4A-II
• eIF4A-II
• EIF4F
• eukaryotic initiation factor 4A-II
• eukaryotic translation initiation factor 4A
• eukaryotic translation initiation factor 4A2

Background

ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and isrequired for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondarystructures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, andsubsequent scanning for the initiator codon

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF4A2