eIF4H Antibody

Images

 
Western Blot: eIF4H Antibody [NBP1-83057] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: eIF4H Antibody [NBP1-83057] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: eIF4H Antibody [NBP1-83057] - Staining of human pancreas shows strong cytoplasmic and nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

eIF4H Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF4H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
eIF4H Protein (NBP1-83057PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for eIF4H Antibody

  • eukaryotic translation initiation factor 4H
  • KIAA0038eIF-4H
  • WBSCR1
  • Williams-Beuren syndrome chromosome region 1
  • WSCR1Williams-Beuren syndrome chromosomal region 1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP2-24632
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
NB100-93308
Species: Hu
Applications: WB, IP
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00003984-M01A
Species: Hu, Mu, Rt
Applications: WB, ELISA, IF
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-30321
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
H00054606-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-83057
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for eIF4H Antibody (NBP1-83057) (0)

There are no publications for eIF4H Antibody (NBP1-83057).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4H Antibody (NBP1-83057) (0)

There are no reviews for eIF4H Antibody (NBP1-83057). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for eIF4H Antibody (NBP1-83057) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional eIF4H Products

Bioinformatics Tool for eIF4H Antibody (NBP1-83057)

Discover related pathways, diseases and genes to eIF4H Antibody (NBP1-83057). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4H Antibody (NBP1-83057)

Discover more about diseases related to eIF4H Antibody (NBP1-83057).
 

Pathways for eIF4H Antibody (NBP1-83057)

View related products by pathway.

PTMs for eIF4H Antibody (NBP1-83057)

Learn more about PTMs related to eIF4H Antibody (NBP1-83057).

Blogs on eIF4H

There are no specific blogs for eIF4H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our eIF4H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4H