EIF2 beta Antibody (2F3)

Images

 
Western Blot: EIF2 beta Antibody (2F3) [H00008894-M09] - Analysis of EIF2S2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: EIF2 beta Antibody (2F3) [H00008894-M09] - Analysis of monoclonal antibody to EIF2S2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: EIF2 beta Antibody (2F3) [H00008894-M09] - Analysis of monoclonal antibody to EIF2S2 on formalin-fixed paraffin-embedded human pancreatic cancer. Antibody concentration 3 ug/ml
Western Blot: EIF2 beta Antibody (2F3) [H00008894-M09] - Analysis of EIF2S2 expression in HeLa (Cat # L013V1).
Western Blot: EIF2 beta Antibody (2F3) [H00008894-M09] - Analysis of EIF2S2 expression in PC-12 (Cat # L012V1).
Western Blot: EIF2 beta Antibody (2F3) [H00008894-M09] - Analysis of EIF2S2 expression in Raw 264.7 (Cat # L024V1).
Western Blot: EIF2 beta Antibody (2F3) [H00008894-M09] - Analysis of EIF2S2 expression in transfected 293T cell line by EIF2S2 monoclonal antibody (M09), clone 2F3. Lane 1: EIF2S2 transfected lysatE (38.4 KDa). Lane 2: ...read more
ELISA: EIF2 beta Antibody (2F3) [H00008894-M09] - Detection limit for recombinant GST tagged EIF2S2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EIF2 beta Antibody (2F3) Summary

Immunogen
EIF2S2 (NP_003899.2, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD
Specificity
EIF2S2 - eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa (2F3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EIF2S2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EIF2 beta Antibody (2F3)

  • DKFZp686L18198
  • EIF2
  • EIF2B
  • EIF2beta
  • eIF-2-beta
  • eukaryotic initiation factor 2-beta
  • eukaryotic translation initiation factor 2 beta
  • eukaryotic translation initiation factor 2 subunit 2
  • Eukaryotic translation initiation factor 2 subunit beta
  • eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
  • eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
  • MGC8508

Background

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30448
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P, KO
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu
Applications: WB, IHC, IP, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24529
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB600-1049
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-03605
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for EIF2 beta Antibody (H00008894-M09) (0)

There are no publications for EIF2 beta Antibody (H00008894-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2 beta Antibody (H00008894-M09) (0)

There are no reviews for EIF2 beta Antibody (H00008894-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EIF2 beta Antibody (H00008894-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EIF2 beta Antibody (H00008894-M09)

Discover related pathways, diseases and genes to EIF2 beta Antibody (H00008894-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF2 beta Antibody (H00008894-M09)

Discover more about diseases related to EIF2 beta Antibody (H00008894-M09).
 

Pathways for EIF2 beta Antibody (H00008894-M09)

View related products by pathway.

Research Areas for EIF2 beta Antibody (H00008894-M09)

Find related products by research area.

Blogs on EIF2 beta

There are no specific blogs for EIF2 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF2 beta Antibody (2F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2S2
Entrez
Uniprot