EIF3S3 Antibody

Images

 
Western Blot: EIF3S3 Antibody [NBP1-84870] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: EIF3S3 Antibody [NBP1-84870] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: EIF3S3 Antibody [NBP1-84870] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: EIF3S3 Antibody [NBP1-84870] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIF3S3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QQQQKHQYQQRRQQENMQRQSRGEPPLPEEDLSKLFKPPQPPARMDSLLIAGQINTYCQNIKEFTAQNLGKLFMAQALQEYNN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF3H
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIF3S3 Protein (NBP1-84870PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EIF3S3 Antibody

  • eIF-3-gamma
  • eIF3-gamma
  • eIF3h
  • eIF3-p40
  • EIF3S3eIF3 p40 subunit
  • Eukaryotic translation initiation factor 3 subunit 3
  • eukaryotic translation initiation factor 3 subunit H
  • eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD)
  • eukaryotic translation initiation factor 3, subunit 3 (gamma, 40kD)
  • eukaryotic translation initiation factor 3, subunit 3 gamma, 40kDa
  • eukaryotic translation initiation factor 3, subunit H
  • MGC102958

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-38612
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
409-ML/CF
Species: Mu
NBP1-77997
Species: Hu, Mu, Rt, Bv, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-81796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91875
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
AF4838
Species: Hu
Applications: WB, Simple Western
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-98293
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP

Publications for EIF3S3 Antibody (NBP1-84870) (0)

There are no publications for EIF3S3 Antibody (NBP1-84870).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF3S3 Antibody (NBP1-84870) (0)

There are no reviews for EIF3S3 Antibody (NBP1-84870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EIF3S3 Antibody (NBP1-84870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF3S3 Products

Bioinformatics Tool for EIF3S3 Antibody (NBP1-84870)

Discover related pathways, diseases and genes to EIF3S3 Antibody (NBP1-84870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF3S3 Antibody (NBP1-84870)

Discover more about diseases related to EIF3S3 Antibody (NBP1-84870).
 

Pathways for EIF3S3 Antibody (NBP1-84870)

View related products by pathway.

PTMs for EIF3S3 Antibody (NBP1-84870)

Learn more about PTMs related to EIF3S3 Antibody (NBP1-84870).
 

Research Areas for EIF3S3 Antibody (NBP1-84870)

Find related products by research area.

Blogs on EIF3S3

There are no specific blogs for EIF3S3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF3S3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF3H