EIF3F Antibody - BSA Free

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Western Blot: EIF3F Antibody [NBP3-38366] - Western blot analysis of lysates from HeLa cells, using EIF3F Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of EIF3F in paraffin-embedded Mouse spleen tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: EIF3F Antibody [NBP3-38366] - Immunofluorescence analysis of NIH/3T3 cells using EIF3F Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: EIF3F Antibody [NBP3-38366] - Immunofluorescence analysis of PC-12 cells using EIF3F Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of EIF3F in paraffin-embedded Human pancreas tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of EIF3F in paraffin-embedded Human colon tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: EIF3F Antibody [NBP3-38366] - Immunohistochemistry analysis of EIF3F in paraffin-embedded Rat brain tissue using EIF3F Rabbit pAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EIF3F Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EIF3F Antibody - BSA Free (NBP3-38366) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 88-357 of human EIF3F (NP_003745.1).
  
  Sequence:
  GGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF3F
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/ml
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EIF3F Antibody - BSA Free

• eIF3 p47
• eIF-3-epsilon
• eIF3-epsilon
• eIF3f
• eIF3-p47
• EIF3S5eukaryotic translation initiation factor 3 subunit F
• Eukaryotic translation initiation factor 3 subunit 5
• eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD)
• eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa
• eukaryotic translation initiation factor 3, subunit F

Background

eIF3f, also known as eukaryotic translation initiation factor 3 subunit 5, eIF-3 epsilon, and eIF3 p47 subunit, binds to the 40S ribosome and promotes the binding of methionyl-tRNA and mRNA. EIF3f also associates with the complex p170-eIF3. eIF-3 is composed of at least 12 different subunits, eIF3f is one of these subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF3F