| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids 1019-1168 of human EGFR's cytoplasmic domain (UniProtKB - P00533): QQGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLD |
| Specificity | Specificity of human EGFR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EGFR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 25106426). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for EGFR Antibody (NBP1-84814)Discover more about diseases related to EGFR Antibody (NBP1-84814).
| Pathways for EGFR Antibody (NBP1-84814)View related products by pathway.
|
PTMs for EGFR Antibody (NBP1-84814)Learn more about PTMs related to EGFR Antibody (NBP1-84814).
| Research Areas for EGFR Antibody (NBP1-84814)Find related products by research area.
|
|
Dual applications of a c-Myc antibody in mitochondrial research c-Myc, a proto-oncogene, has documented involvement in cellular differentiation, cell growth, cell death and tumor formation. Target genes of the Myc family include those that participate in cell survival, translation, transcription, metabolism and... Read full blog post. |
|
The dynamic use of a PCNA antibody in fish, porcine and primate species Proliferating cell nuclear antigen (PCNA) plays a crucial role in nucleic acid metabolism as it pertains to DNA replication and repair. Most noted for its activation of subunits of DNA polymerase, it has also been found to interact with cell-cycl... Read full blog post. |
|
Using a STAT3 antibody in chromatin immunoprecipitation (ChIP) Signal transducer and activator of transcription 3 (STAT3) is an important oncogenic transcriptional factor that mediates tumor induced immune suppression. Specifically, STAT3 transmits signals from cytokines and growth factor receptors in the pla... Read full blog post. |
|
Beta Tubulin III and neurogenesis Beta tubulin III, also known as Tuj-1, is a class III member of the beta tubulin protein family. Beta tubulins are one of two structural components that form our microtubule network. While general tubulins play a role in a wide range of cellular pr... Read full blog post. |
|
The relationship between Ki67 and HIF-1 in cancer Ki67, also known as MKI67, is best known as the leading marker of cellular proliferation. Ki67 is regulated by a balance between synthesis and degradation, and often carries a very short half-life. First discovered to be located to dividing cells,... Read full blog post. |
|
Niemann Pick-C1 and cholesterol dynamics Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis. Although cholesterol moves freely inside the cell, it cannot independently expo... Read full blog post. |
|
MAPK3/ERK1 - A signal transduction pathway with roles in development and disease Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos... Read full blog post. |
|
Using EGF Protein from Novus Biologicals EGF (epidermal growth factor) stimulates differentiation, proliferation and cell growth by binding to its receptor, EGFR. EGF was first discovered in the mouse submandibular gland in 1986 by Stanley Cohen of Vanderbilt University, leading to a Nobel P... Read full blog post. |
|
It's a Wiz: Merlin Antibodies Advance Hepatic Tumor Research The NF2 gene, also known as “Merlin”, was discovered through studies into Neurofibromatosis Type II, a rare genetic disease which causes formation of non-malignant, but life-limiting, brain tumors. NF2 encodes a cytoskeletal protein involved in extrac... Read full blog post. |
|
The Magic of Merlin: Antibodies Point to New Role in Liver Cancer The Merlin protein belongs to the ezrin/radixin/moesin (ERM) family of tumour suppressor proteins. Encoded by the rather less imaginatively named Neurofibromin 2 (NF2) gene, it is thought to play a role in extracellular signal transduction, linking th... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EGFR |