![Immunohistochemistry-Paraffin: DUSP27/DUPD1 Antibody [NBP1-84040] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/DUSP27-DUPD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84040-img0003.jpg "Immunohistochemistry-Paraffin: DUSP27/DUPD1 Antibody [NBP1-84040] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit DUSP27/DUPD1 Antibody - BSA Free (NBP1-84040) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DUPD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Block_Neutralize_8779.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF1445_Western_Blot_20179.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1445_mouse-rat-prolactin-affinity-purified-polyclonal-ab-immunohistochemistry-19202393922..jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Rat | 03/10/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for DUSP27/DUPD1 Antibody (NBP1-84040)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DUPD1 |
![Western Blot: DUSP27/DUPD1 Antibody [NBP1-84040] - Rat soleus muscle loaded at 10, 20, 30 and 40 µg protein in lanes 2-5, and lanes 6-9. DUSP29 ab was diluted in 5% BSA/TBST or 3% milk/TBST and incubated overnight at 4°C. Secondary ab in 5%milk/TBST at 1:20K for 1 hour at RT. Image from verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-84040_rabbit-polyclonal-dusp27-dupd1-antibody-western-blot-204202395052.jpg "Western Blot: DUSP27/DUPD1 Antibody [NBP1-84040] - Rat soleus muscle loaded at 10, 20, 30 and 40 µg protein in lanes 2-5, and lanes 6-9. DUSP29 ab was diluted in 5% BSA/TBST or 3% milk/TBST and incubated overnight at 4°C. Secondary ab in 5%milk/TBST at 1:20K for 1 hour at RT. Image from verified customer review.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_6181.jpg)
![Western Blot CDC14 Antibody (472508) [Unconjugated]](https://images.novusbio.com/images2/CDC14_MAB4457_Western_Blot_23533.jpg)
![N/A CXCL11/I-TAC [HRP]](https://images.novusbio.com/images2/DATA_CXCL11_DCX110_ELISA_640.jpg)
![N/A CXCL11/I-TAC [HRP]](https://images.novusbio.com/images2/DATA_CXCL11_DCX110_ELISA_641.jpg)
![N/A CXCL11/I-TAC [HRP]](https://images.novusbio.com/images2/CXCL11_DCX110_ELISA_71.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
