DUSP18 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DUSP18 Antibody [NBP2-57138] - Staining of human cell line A-431 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DUSP18 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DUSP18 Antibody - BSA Free (NBP2-57138) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: APSCAFPVQFRQPSVSGLSQITKSLYISNGVAATN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP18
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DUSP18 Recombinant Protein Antigen (NBP2-57138PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DUSP18 Antibody - BSA Free

• bK963H5.1
• DSP18
• dual specificity phosphatase 18
• dual specificity protein phosphatase 18
• DUSP20
• EC 3.1.3.16
• EC 3.1.3.48
• LMWDSP20
• LMW-DSP20
• Low molecular weight dual specificity phosphatase 20
• MGC32658

Background

DUSP18 is a member of the dual-specificity phosphatase (DSP) family (see DUSP1; MIM 600714), which catalyzes dephosphorylation of phosphotyrosine and phosphothreonine residues (Hood et al., 2002 [PubMed 12408986]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DUSP18