DUSP18 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DUSP18 Antibody [NBP2-57138] - Staining of human cell line A-431 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP18 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: APSCAFPVQFRQPSVSGLSQITKSLYISNGVAATN
Specificity
Specificity of human DUSP18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP18
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DUSP18 Recombinant Protein Antigen (NBP2-57138PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DUSP18 Antibody

  • bK963H5.1
  • DSP18
  • dual specificity phosphatase 18
  • dual specificity protein phosphatase 18
  • DUSP20
  • EC 3.1.3.16
  • EC 3.1.3.48
  • LMWDSP20
  • LMW-DSP20
  • Low molecular weight dual specificity phosphatase 20
  • MGC32658

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
MAB1654
Species: Hu, Mu, Rt
Applications: WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4640
Species: Hu
Applications: WB
MAB4457
Species: Hu, Mu, Rt
Applications: WB
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001018-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
H00063904-B01P
Species: Hu
Applications: WB
NBP2-94901
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-67909
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-93937
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DUSP18 Antibody (NBP2-57138) (0)

There are no publications for DUSP18 Antibody (NBP2-57138).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP18 Antibody (NBP2-57138) (0)

There are no reviews for DUSP18 Antibody (NBP2-57138). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DUSP18 Antibody (NBP2-57138) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DUSP18 Products

Bioinformatics Tool for DUSP18 Antibody (NBP2-57138)

Discover related pathways, diseases and genes to DUSP18 Antibody (NBP2-57138). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for DUSP18 Antibody (NBP2-57138)

View related products by pathway.

PTMs for DUSP18 Antibody (NBP2-57138)

Learn more about PTMs related to DUSP18 Antibody (NBP2-57138).
 

Research Areas for DUSP18 Antibody (NBP2-57138)

Find related products by research area.

Blogs on DUSP18

There are no specific blogs for DUSP18, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP18 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP18