DUSP14 Antibody - BSA Free

Western Blot: DUSP14 Antibody [NBP1-81046] - Analysis in control (vector only transfected HEK293T lysate) and DUSP14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: DUSP14 Antibody [NBP1-81046] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Staining of human testis shows strong cytoplasm positivity in seminiferous ducts.

Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Stainin gof human skin shows strong cytoplasm postivity in squamous epithelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DUSP14 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVS
• Predicted Species: Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DUSP14
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DUSP14 Protein (NBP1-81046PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DUSP14 Antibody - BSA Free

• dual specificity phosphatase 14
• EC 3.1.3.16
• EC 3.1.3.48
• MAP kinase phosphatase 6
• Mitogen-activated protein kinase phosphatase 6
• MKP-1 like protein tyrosine phosphatase
• MKP-1-like protein tyrosine phosphatase
• MKP-6
• MKP6MKP-Ldual specificity protein phosphatase 14

Background

Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-basedprotein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosineand serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP(mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009(PubMed 19228121)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DUSP14 Antibody (NBP1-81046)(2)

Publications using NBP1-81046

• T Douglas, M Saleh Post-translational Modification of OTULIN Regulates Ubiquitin Dynamics and Cell Death Cell Rep, 2019-12-10;29(11):3652-3663.e5. 2019-12-10 [PMID: 31825842]
• Zhang J, Wu Y, Xu J et al. Neuroprotective effects of electro-acupuncture in spinal cord injury rats via up-regulation of DUSP14. Tropical Journal of Pharmaceutical Research

Bioinformatics

• Gene Symbol: DUSP14
• Entrez:
  • 11072(Human)
• Uniprot:
  • O95147(Human)