DUSP14 Antibody

Images

 
Western Blot: DUSP14 Antibody [NBP1-81046] - Analysis in control (vector only transfected HEK293T lysate) and DUSP14 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: DUSP14 Antibody [NBP1-81046] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Staining of human fallopian tube shows strong cytoplasmic and membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Staining of human testis shows strong cytoplasm positivity in seminiferous ducts.
Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Stainin gof human skin shows strong cytoplasm postivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVS
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DUSP14 Protein (NBP1-81046PEP)
Publications
Read Publication using NBP1-81046.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP14 Antibody

  • dual specificity phosphatase 14
  • EC 3.1.3.16
  • EC 3.1.3.48
  • MAP kinase phosphatase 6
  • Mitogen-activated protein kinase phosphatase 6
  • MKP-1 like protein tyrosine phosphatase
  • MKP-1-like protein tyrosine phosphatase
  • MKP-6
  • MKP6MKP-Ldual specificity protein phosphatase 14

Background

Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-basedprotein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosineand serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP(mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009(PubMed 19228121)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DUSP14 Antibody (NBP1-81046)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-81046 Applications Species
Zhang J, Wu Y, Xu J et al. Neuroprotective effects of electro-acupuncture in spinal cord injury rats via up-regulation of DUSP14. Tropical Journal of Pharmaceutical Research

Reviews for DUSP14 Antibody (NBP1-81046) (0)

There are no reviews for DUSP14 Antibody (NBP1-81046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DUSP14 Antibody (NBP1-81046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP14 Products

Research Areas for DUSP14 Antibody (NBP1-81046)

Find related products by research area.

Blogs on DUSP14

There are no specific blogs for DUSP14, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP14
Entrez
Uniprot