DUSP14 Antibody

Images

 
Western Blot: DUSP14 Antibody [NBP1-81046] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Negative control (vector only transfected HEK293T lysate), Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: DUSP14 Antibody [NBP1-81046] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: DUSP14 Antibody [NBP1-81046] - Staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DUSP14 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DUSP14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DUSP14 Protein (NBP1-81046PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DUSP14 Antibody

  • dual specificity phosphatase 14
  • EC 3.1.3.16
  • EC 3.1.3.48
  • MAP kinase phosphatase 6
  • Mitogen-activated protein kinase phosphatase 6
  • MKP-1 like protein tyrosine phosphatase
  • MKP-1-like protein tyrosine phosphatase
  • MKP-6
  • MKP6MKP-Ldual specificity protein phosphatase 14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
MAB7475
Species: Hu, Rt
Applications: WB
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DUSP14 Antibody (NBP1-81046) (0)

There are no publications for DUSP14 Antibody (NBP1-81046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DUSP14 Antibody (NBP1-81046) (0)

There are no reviews for DUSP14 Antibody (NBP1-81046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DUSP14 Antibody (NBP1-81046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DUSP14 Products

Bioinformatics Tool for DUSP14 Antibody (NBP1-81046)

Discover related pathways, diseases and genes to DUSP14 Antibody (NBP1-81046). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DUSP14 Antibody (NBP1-81046)

Discover more about diseases related to DUSP14 Antibody (NBP1-81046).
 

Pathways for DUSP14 Antibody (NBP1-81046)

View related products by pathway.

PTMs for DUSP14 Antibody (NBP1-81046)

Learn more about PTMs related to DUSP14 Antibody (NBP1-81046).
 

Research Areas for DUSP14 Antibody (NBP1-81046)

Find related products by research area.

Blogs on DUSP14

There are no specific blogs for DUSP14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DUSP14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP14