CMYA3 Antibody

Images

 
Immunohistochemistry: CMYA3 Antibody [NBP1-88066] - Staining of human kidney shows strong cytoplasmic positivity in a subset of cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CMYA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HAPPTYEDVIAGHILDISDSPKEVRKNFQKTWQESGRVFKGLGYATADASATEMRTTFQEESAFISEAAAPRQGNMYTLSKDSLSNGVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
XIRP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CMYA3 Protein (NBP1-88066PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CMYA3 Antibody

  • DKFZp779G1747
  • xin actin-binding repeat containing 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-03339
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76905
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32462
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1396
Species: Hu
Applications: WB
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33286
Species: Hu
Applications: IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-81844
Species: Hu
Applications: IHC, IHC-P
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-07047
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP1-88066
Species: Hu
Applications: IHC, IHC-P

Publications for CMYA3 Antibody (NBP1-88066) (0)

There are no publications for CMYA3 Antibody (NBP1-88066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CMYA3 Antibody (NBP1-88066) (0)

There are no reviews for CMYA3 Antibody (NBP1-88066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CMYA3 Antibody (NBP1-88066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CMYA3 Products

Bioinformatics Tool for CMYA3 Antibody (NBP1-88066)

Discover related pathways, diseases and genes to CMYA3 Antibody (NBP1-88066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CMYA3 Antibody (NBP1-88066)

Discover more about diseases related to CMYA3 Antibody (NBP1-88066).
 

Pathways for CMYA3 Antibody (NBP1-88066)

View related products by pathway.

Blogs on CMYA3

There are no specific blogs for CMYA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CMYA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol XIRP2