DTX1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human Lymph node shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Analysis in human lymph node and placenta tissues using NBP2-58472 antibody. Corresponding DTX1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human Cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human Cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human Placenta shows no positivity in trophoblastic cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DTX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DTX1 Antibody - BSA Free (NBP2-58472) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DTX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DTX1 Recombinant Protein Antigen (NBP2-58472PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DTX1 Antibody - BSA Free

• deltex homolog 1 (Drosophila)
• Deltex1
• DTX1
• Dx-1
• hDTX1
• hDx-1
• protein deltex-1

Background

DTX1, also known as E3 ubiquitin-protein ligase DTX1, is a 67.4 kDa, 620 amino acid protein that is involved in regulating the Notch pathway by monitoring ubiquitination and stimulating the breakdown of MEKK1. Current research is being conducted with diseases and disorders such as osteosarcoma, Noonan syndrome, and neuronitis. The protein interacts in disease and Notch signaling pathways with CRK, ITCH, UBE2D2, UBE2D3, and UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DTX1