DTX1 Antibody

Images

 
Immunohistochemistry-Paraffin: DTX1 Antibody [NBP2-58472] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DTX1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP
Specificity
Specificity of human DTX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DTX1 Antibody

  • deltex homolog 1 (Drosophila)
  • Deltex1
  • DTX1
  • Dx-1
  • hDTX1
  • hDx-1
  • protein deltex-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP2-13941
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33427
Species: Hu
Applications: WB, ICC/IF, ChIP
NBP1-47791
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00008209-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-27347
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB600-302
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-31789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005729-B01P
Species: Hu
Applications: WB, Flow
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF
NBP2-58472
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DTX1 Antibody (NBP2-58472) (0)

There are no publications for DTX1 Antibody (NBP2-58472).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTX1 Antibody (NBP2-58472) (0)

There are no reviews for DTX1 Antibody (NBP2-58472). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DTX1 Antibody (NBP2-58472) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DTX1 Products

Array NBP2-58472

Bioinformatics Tool for DTX1 Antibody (NBP2-58472)

Discover related pathways, diseases and genes to DTX1 Antibody (NBP2-58472). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTX1 Antibody (NBP2-58472)

Discover more about diseases related to DTX1 Antibody (NBP2-58472).
 

Pathways for DTX1 Antibody (NBP2-58472)

View related products by pathway.

PTMs for DTX1 Antibody (NBP2-58472)

Learn more about PTMs related to DTX1 Antibody (NBP2-58472).
 

Research Areas for DTX1 Antibody (NBP2-58472)

Find related products by research area.

Blogs on DTX1

There are no specific blogs for DTX1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DTX1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTX1
COVID-19 update