DTX1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
DTX1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for DTX1 Antibody - BSA Free
Background
DTX1, also known as E3 ubiquitin-protein ligase DTX1, is a 67.4 kDa, 620 amino acid protein that is involved in regulating the Notch pathway by monitoring ubiquitination and stimulating the breakdown of MEKK1. Current research is being conducted with diseases and disorders such as osteosarcoma, Noonan syndrome, and neuronitis. The protein interacts in disease and Notch signaling pathways with CRK, ITCH, UBE2D2, UBE2D3, and UBC.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ChIP, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Publications for DTX1 Antibody (NBP2-58472) (0)
There are no publications for DTX1 Antibody (NBP2-58472).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for DTX1 Antibody (NBP2-58472) (0)
There are no reviews for DTX1 Antibody (NBP2-58472).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for DTX1 Antibody (NBP2-58472) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional DTX1 Products
Research Areas for DTX1 Antibody (NBP2-58472)
Find related products by research area.
|
Blogs on DTX1