DTX3 Antibody


Immunocytochemistry/ Immunofluorescence: DTX3 Antibody [NBP2-31789] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus, nucleoli & the Golgi apparatus.
Immunohistochemistry-Paraffin: DTX3 Antibody [NBP2-31789] - Staining of human stomach, upper shows strong cytoplasmic positivity in parietal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

DTX3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMC
Specificity of human DTX3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DTX3 Protein (NBP2-31789PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DTX3 Antibody

  • deltex 3 homolog (Drosophila)
  • deltex homolog 3 (Drosophila)
  • deltex3
  • FLJ34766
  • MGC138863
  • MGC138864
  • protein deltex-3
  • RING finger protein 154
  • RNF154deltex 3 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for DTX3 Antibody (NBP2-31789) (0)

There are no publications for DTX3 Antibody (NBP2-31789).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTX3 Antibody (NBP2-31789) (0)

There are no reviews for DTX3 Antibody (NBP2-31789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DTX3 Antibody (NBP2-31789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DTX3 Products

Bioinformatics Tool for DTX3 Antibody (NBP2-31789)

Discover related pathways, diseases and genes to DTX3 Antibody (NBP2-31789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTX3 Antibody (NBP2-31789)

Discover more about diseases related to DTX3 Antibody (NBP2-31789).

PTMs for DTX3 Antibody (NBP2-31789)

Learn more about PTMs related to DTX3 Antibody (NBP2-31789).

Research Areas for DTX3 Antibody (NBP2-31789)

Find related products by research area.

Blogs on DTX3

There are no specific blogs for DTX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DTX3 Antibody and receive a gift card or discount.


Gene Symbol DTX3