DTX3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DTX3 Antibody [NBP2-31789] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleus, nucleoli & the Golgi apparatus.

Immunohistochemistry-Paraffin: DTX3 Antibody [NBP2-31789] - Staining of human stomach, upper shows strong cytoplasmic positivity in parietal cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DTX3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DTX3 Antibody - BSA Free (NBP2-31789) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMC
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DTX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DTX3 Protein (NBP2-31789PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DTX3 Antibody - BSA Free

• deltex 3 homolog (Drosophila)
• deltex homolog 3 (Drosophila)
• deltex3
• FLJ34766
• MGC138863
• MGC138864
• protein deltex-3
• RING finger protein 154
• RNF154deltex 3 homolog

Background

DTX3 encodes a probable E3 ubiquitin-protein ligase DTX3 that exists in two isoforms: Isoform 1 id 347 amino acids long at nearly 38 kDA, while isoform 2 is 350 amino acids long at 38 kDA as well. DTX3 is involved in the notch signaling pathway and protein modification and is known to interact with genes UBE2D2, UBE2D3, UBE2L6, UBE2V1, and UBE2W. It is critical in cell to cell communication that affects cell-fate determinations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DTX3
• Uniprot:
  • Q8N9I9(Human)