DTX2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DTX2 Antibody [NBP2-13941] - Staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DTX2 Antibody [NBP2-13941] - Staining of human Testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: DTX2 Antibody [NBP2-13941] - Staining of human Cerebral cortex shows moderate nuclear and cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: DTX2 Antibody [NBP2-13941] - Staining of human Colon shows moderate nuclear and cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: DTX2 Antibody [NBP2-13941] - Staining of human Esophagus shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: DTX2 Antibody [NBP2-13941] - Staining of human Tonsil shows moderate nuclear and cytoplasmic positivity in squamous epithelial cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DTX2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DTX2 Antibody - BSA Free (NBP2-13941) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: YPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQHPPHRTASVFGTHQAFAPYNKPSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DTX2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
• Control Peptide:

  DTX2 Protein (NBP2-13941PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DTX2 Antibody - BSA Free

• deltex (Drosophila) homolog 2
• deltex homolog 2 (Drosophila)
• Deltex2
• hDTX2
• MGC71098
• protein deltex-2
• RING finger protein 58
• RNF58KIAA1528deltex2
• zinc ion binding protein

Background

DTX2 functions as an E3 ubiquitin ligase (Takeyama et al., 2003 (PubMed 12670957)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DTX2