DTX2 Antibody

Images

 
Western Blot: DTX2 Antibody [NBP2-13941] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: DTX2 Antibody [NBP2-13941] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry-Paraffin: DTX2 Antibody [NBP2-13941] - Staining of human esophagus shows cytoplasmic and nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DTX2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YPVTTIIAPPGHTGVACSCHQCLSGSRTGPVSGRYRHSMTNLPAYPVPQH PPHRTASVFGTHQAFAPYNKPSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DTX2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
DTX2 Protein (NBP2-13941PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DTX2 Antibody

  • deltex (Drosophila) homolog 2
  • deltex homolog 2 (Drosophila)
  • Deltex2
  • hDTX2
  • MGC71098
  • protein deltex-2
  • RING finger protein 58
  • RNF58KIAA1528deltex2
  • zinc ion binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7157
Species: Hu
Applications: WB, CyTOF-ready, ICC, ICFlow
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
H00005308-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
46780002
Species: Hu
Applications: ELISA
NBP2-31789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF4079
Species: Hu
Applications: WB, ICC
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-32276
Species: Hu
Applications: WB, IP
AF4409
Species: Mu
Applications: WB
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB2388
Species: Hu
Applications: WB, IHC
NBP2-13941
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DTX2 Antibody (NBP2-13941) (0)

There are no publications for DTX2 Antibody (NBP2-13941).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTX2 Antibody (NBP2-13941) (0)

There are no reviews for DTX2 Antibody (NBP2-13941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DTX2 Antibody (NBP2-13941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DTX2 Products

Bioinformatics Tool for DTX2 Antibody (NBP2-13941)

Discover related pathways, diseases and genes to DTX2 Antibody (NBP2-13941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTX2 Antibody (NBP2-13941)

Discover more about diseases related to DTX2 Antibody (NBP2-13941).
 

Pathways for DTX2 Antibody (NBP2-13941)

View related products by pathway.

PTMs for DTX2 Antibody (NBP2-13941)

Learn more about PTMs related to DTX2 Antibody (NBP2-13941).

Blogs on DTX2

There are no specific blogs for DTX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DTX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DTX2