We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DRP1 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining in human cerebral cortex and pancreas tissues.. Corresponding DNM1L RNA-seq data are presented for the same tissues.
Western Blot: DRP1 Antibody [NBP2-34205] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DRP1 Antibody [NBP2-34205] - Staining of human cell line U-251 MG shows localization to cytosol and vesicles.
Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: DRP1 Antibody [NBP2-34205] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

DRP1 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNM1L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Rat (85%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DRP1 Antibody - BSA Free

  • DLP1
  • DNM1L
  • DRP1
  • DRP1Dnm1p/Vps1p-like protein
  • DVLP
  • DVLPEC 3.6.5.5
  • Dymple
  • DYMPLEDYNIV-11
  • dynamin 1-like
  • Dynamin family member proline-rich carboxyl-terminal domain less
  • dynamin-1-like protein
  • Dynamin-like protein 4
  • Dynamin-like protein IV
  • Dynamin-like protein
  • Dynamin-related protein 1
  • FLJ41912
  • HdynIV
  • VPS1

Background

DRP1 is a member of the dynamin GTPase superfamily, which that contributes to mitochondrial division in mammalian cells. DRP1 plays this important role in mitochondrial fission at steady state and during apoptosis. DRP1 is required for proper cellular distribution of mitochondria, and in mutant neurons, mitochondria are largely absent from synapses. Therefore, DRP1 provides a genetic tool to assess the role of mitochondria at synapses.

The DRP1 gene has 3 alternatively spliced transcripts encoding different isoforms, which are alternatively polyadenylated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, RNAi, WB
NBP1-71775
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB110-55290
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC,  IHC-P, IP, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr,  IHC-P, WB
NBP3-15642
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-60491
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-Fr,  IHC-P, IP, KO, Simple Western, WB
NBP3-47447
Species: Hu, Rt
Applications: ELISA, IHC, WB
BC100-494
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC,  IHC-P, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
AF816
Species: Hu
Applications: ICC, IHC, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-86799
Species: Hu
Applications: IHC,  IHC-P
NBP2-34205
Species: Hu, Mu
Applications: WB, ICC/IF, IHC

Publications for DRP1 Antibody (NBP2-34205) (0)

There are no publications for DRP1 Antibody (NBP2-34205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRP1 Antibody (NBP2-34205) (0)

There are no reviews for DRP1 Antibody (NBP2-34205). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DRP1 Antibody (NBP2-34205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRP1 Products

Research Areas for DRP1 Antibody (NBP2-34205)

Find related products by research area.

Blogs on DRP1.

Methamphetamine with HIV induces mitochondrial dysfunction and neuronal injury through oxidative stress
By Jamshed Arslan, Pharm. D., PhD. December 1 is the World AIDS Day. Despite the combination antiretroviral therapy, 10-25% of Human Immunodeficiency Virus (HIV)-positive individuals report neurocognitive impairm...  Read full blog post.

Understanding Mitophagy Mechanisms: Canonical PINK1/Parkin, LC3-Dependent Piecemeal, and LC3-Independent Mitochondrial Derived Vesicles
By Christina Towers, PhD What is Mitophagy?The selective degradation of mitochondria via double membrane autophagosome vesicles is called mitophagy. Damaged mitochondria can generate harmful amounts of reactive ox...  Read full blog post.

Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease
 By Jamshed Arslan Pharm.D.  Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy...  Read full blog post.

Dynamin-related Protein 1 (DRP1) in Mitochondria and Apoptosis.
Dynamin-related Protein 1 (DRP1) is known to function in mitochondrial and peroxisomal division and mediate membrane fission through oligomerization into ring-like structure and sever the mitochondrial membrane, through a GTP hydrolysis-dependent mech...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRP1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol DNM1L
Uniprot