MFF Antibody

Images

 
Immunohistochemistry-Paraffin: MFF Antibody [NBP1-86799] - Staining of human gallbladder shows weak cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MFF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 26680008).
Control Peptide
MFF Protein (NBP1-86799PEP)
Publications
Read Publications using
NBP1-86799 in the following applications:

  • WB
    3 publications

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 25012575).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MFF Antibody

  • mitochondrial fission factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-75449
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84074
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-13913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56646
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-66383
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59480
Species: Hu
Applications: WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-34081
Species: Hu
Applications: IHC, IHC-P, WB
NB110-55290
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NB110-60491
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-Fr, IHC-P, IP, KO, Simple Western, WB
NB100-2357
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
H00055669-M04
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
NBP2-38683
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45626
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB91871
Species: Hu
Applications: Flow (-), ICC, IHC, IHC-P, Simple Western, WB
NBP1-84430
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MFF Antibody (NBP1-86799)(4)

Reviews for MFF Antibody (NBP1-86799) (0)

There are no reviews for MFF Antibody (NBP1-86799). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MFF Antibody (NBP1-86799) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MFF Products

Bioinformatics Tool for MFF Antibody (NBP1-86799)

Discover related pathways, diseases and genes to MFF Antibody (NBP1-86799). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFF Antibody (NBP1-86799)

Discover more about diseases related to MFF Antibody (NBP1-86799).
 

Pathways for MFF Antibody (NBP1-86799)

View related products by pathway.

PTMs for MFF Antibody (NBP1-86799)

Learn more about PTMs related to MFF Antibody (NBP1-86799).

Blogs on MFF

There are no specific blogs for MFF, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFF