MFF Antibody - BSA Free

Analysis in human testis and liver tissues Corresponding MFF RNA-seq data are presented for the same tissues.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MFF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MFF Antibody - BSA Free (NBP1-86799) is a polyclonal antibody validated for use in IHC and WB. Anti-MFF Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKR
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MFF
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Reported in scientific literature (PMID 26680008).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MFF Protein (NBP1-86799PEP)

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 25012575).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MFF Antibody - BSA Free

• mitochondrial fission factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MFF Antibody (NBP1-86799)(4)

Publications using NBP1-86799

• Hung CH, Cheng SS, Cheung YT et al. A reciprocal relationship between reactive oxygen species and mitochondrial dynamics in neurodegeneration Redox Biol 2017-08-12 [PMID: 28837882] (WB, Rat)
• Vannuvel K, Van Steenbrugge M, Demazy C et al. Effects of a Sublethal and Transient Stress of the Endoplasmic Reticulum on the Mitochondrial Population. J. Cell. Physiol. 2015-12-17 [PMID: 26680008] (WB, Human)
• Cho B, Cho HM, Kim HJ et al. CDK5-dependent inhibitory phosphorylation of Drp1 during neuronal maturation. Exp Mol Med 2014-07-11 [PMID: 25012575] (WB, Rat)
• Li H, Alavian KN, Lazrove E et al. A Bcl-xL-Drp1 complex regulates synaptic vesicle membrane dynamics during endocytosis. Nat Cell Biol 2013-07-01 [PMID: 23792689]

Bioinformatics

• Gene Symbol: MFF