TTC11 Antibody

Images

 
Orthogonal Strategies: Western Blot: TTC11 Antibody [NBP1-85664] - Analysis in human cell lines MCF-7 and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: TTC11 Antibody [NBP1-85664] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Western Blot: TTC11 Antibody [NBP1-85664] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human small intestine shows strong cytoplasmic granular positivity in glandular cells.
Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TTC11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FIS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTC11 Protein (NBP1-85664PEP)
Publications
Read Publications using
NBP1-85664 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23249249)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC11 Antibody

  • CGI-135
  • FIS1 homolog
  • Fis1
  • fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
  • fission 1 (mitochondrial outer membrane) homolog (yeast)
  • H_NH0132A01.6
  • hFis1
  • mitochondrial fission 1 protein
  • tetratricopeptide repeat domain 11
  • Tetratricopeptide repeat protein 11
  • TTC11TPR repeat protein 11

Background

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC11 Antibody (NBP1-85664)(2)

Reviews for TTC11 Antibody (NBP1-85664) (0)

There are no reviews for TTC11 Antibody (NBP1-85664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTC11 Antibody (NBP1-85664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC11 Products

Research Areas for TTC11 Antibody (NBP1-85664)

Find related products by research area.

Blogs on TTC11

There are no specific blogs for TTC11, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FIS1