TTC11 Antibody - BSA Free

Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human Fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.

Staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells.

Analysis in human cell lines MCF-7 and Caco-2 using Anti-FIS1 antibody. Corresponding FIS1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Staining of human cell line U-251 MG shows localization to mitochondria.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TTC11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FIS1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TTC11 Protein (NBP1-85664PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23249249)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TTC11 Antibody - BSA Free

• CGI-135
• FIS1 homolog
• Fis1
• fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
• fission 1 (mitochondrial outer membrane) homolog (yeast)
• H_NH0132A01.6
• hFis1
• mitochondrial fission 1 protein
• tetratricopeptide repeat domain 11
• Tetratricopeptide repeat protein 11
• TTC11TPR repeat protein 11

Background

The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC11 Antibody (NBP1-85664)(2)

Publications using NBP1-85664

• Vannuvel K, Van Steenbrugge M, Demazy C et al. Effects of a Sublethal and Transient Stress of the Endoplasmic Reticulum on the Mitochondrial Population. J. Cell. Physiol. 2015-12-17 [PMID: 26680008] (WB, Human)
• Van Beersel G, Tihon E, Demine S et al. Different molecular mechanisms involved in spontaneous and oxidative stress-induced mitochondrial fragmentation in tripeptidyl peptidase-1 (TPP-1)-deficient fibroblasts. Biosci Rep 2013-02-07 [PMID: 23249249]

Bioinformatics

• Gene Symbol: FIS1