TTC11 Antibody

Images

 
Western Blot: TTC11 Antibody [NBP1-85664] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: TTC11 Antibody [NBP1-85664] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: TTC11 Antibody [NBP1-85664] - Staining of human small intestine shows strong cytoplasmic granular positivity in glandular cells.
Western Blot: TTC11 Antibody [NBP1-85664] - Analysis in human cell line MCF-7.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TTC11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FIS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TTC11 Protein (NBP1-85664PEP)
Publications
Read Publications using
NBP1-85664 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23249249)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TTC11 Antibody

  • CGI-135
  • FIS1 homolog
  • Fis1
  • fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
  • fission 1 (mitochondrial outer membrane) homolog (yeast)
  • H_NH0132A01.6
  • hFis1
  • mitochondrial fission 1 protein
  • tetratricopeptide repeat domain 11
  • Tetratricopeptide repeat protein 11
  • TTC11TPR repeat protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76652
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13913
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-51841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-55290
Species: Hu, Mu, Rt, Po, Ch
Applications: WB, Simple Western, IHC, IHC-P
NB100-2357
Species: Hu, Mu, Pm
Applications: WB, IHC-P, IP
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP2-01512
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-59704
Species: Hu
Applications: WB
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86799
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NBP1-85664
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TTC11 Antibody (NBP1-85664)(2)

Reviews for TTC11 Antibody (NBP1-85664) (0)

There are no reviews for TTC11 Antibody (NBP1-85664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TTC11 Antibody (NBP1-85664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TTC11 Products

Bioinformatics Tool for TTC11 Antibody (NBP1-85664)

Discover related pathways, diseases and genes to TTC11 Antibody (NBP1-85664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TTC11 Antibody (NBP1-85664)

Discover more about diseases related to TTC11 Antibody (NBP1-85664).
 

Pathways for TTC11 Antibody (NBP1-85664)

View related products by pathway.

PTMs for TTC11 Antibody (NBP1-85664)

Learn more about PTMs related to TTC11 Antibody (NBP1-85664).
 

Research Areas for TTC11 Antibody (NBP1-85664)

Find related products by research area.

Blogs on TTC11

There are no specific blogs for TTC11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TTC11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FIS1