DRG2 Antibody - Azide and BSA Free

Western Blot: DRG2 Antibody [NBP2-92638] - Analysis of extracts of various cell lines, using DRG2 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.

Immunocytochemistry/Immunofluorescence: DRG2 Antibody [NBP2-92638] - Immunofluorescence analysis of L929 cells using DRG2 antibody (NBP2-92638) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: DRG2 Antibody [NBP2-92638] - Immunofluorescence analysis of C6 cells using DRG2 antibody (NBP2-92638) at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DRG2 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 150-260 of human DRG2 (NP_001379.1). TKGEVQRSLLEKELESVGIRLNKHKPNIYFKPKKGGGISFNSTVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSPDEFIDVIVGNRVYMPCLYVYNKIDQISMEEVDRLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DRG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500-1:2000
• Theoretical MW: 40 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for DRG2 Antibody - Azide and BSA Free

• developmentally regulated GTP binding protein 2
• developmentally regulated GTP-binding protein 2
• developmentally-regulated GTP-binding protein 2
• DRG-2

Background

The DRG2 gene encodes the developmentally regulated GTP-binding protein 2, a name derived from the fact that it sharessignificant similarity to known GTP-binding proteins. DRG2 was identified because it is expressed in normalfibroblasts but not in SV40-transformed fibroblasts. Read-through transcripts containing this gene and a downstreamgene have been identified, but they are not thought to encode a fusion protein. This gene is located within theSmith-Magenis syndrome region on chromosome 17. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: DRG2