ZC3H15 Antibody - BSA Free

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: ZC3H15 Antibody [NBP1-81312] - Staining of human breast, cerebral cortex, colon and testis using Anti-ZC3H15 antibody NBP1-81312 (A) shows similar protein ...read more
Genetic Strategies: Western Blot: ZC3H15 Antibody [NBP1-81312] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading ...read more
Immunocytochemistry/ Immunofluorescence: ZC3H15 Antibody [NBP1-81312] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: ZC3H15 Antibody [NBP1-81312] - Staining of human colon.
Immunohistochemistry-Paraffin: ZC3H15 Antibody [NBP1-81312] - Staining of human breast.
Immunohistochemistry-Paraffin: ZC3H15 Antibody [NBP1-81312] - Staining of human testis.
Immunohistochemistry-Paraffin: ZC3H15 Antibody [NBP1-81312] - Staining of human cerebral cortex.
EGFR overexpression significantly restored cell proliferation, migration, and invasion of ZC3H15-knockdown GBM cells.A The protein level of ZC3H15 and EGFR were detected in the indicated GBM cells. B MTT assays were ...read more
ZC3H15 activates the EGFR-mediated signaling pathway by increasing EGFR protein stability.A Western blot analysis was performed to detect the expression of EGFR signaling proteins (EGFR, p-EGFR, AKT, p-AKT) of GBM ...read more
ZC3H15 is commonly upregulated in GBM and correlates with poor prognosis.A, B ZC3H15 gene expression was obtained from TCGA and CGGA database. Box plot of ZC3H15 expression levels in Grade and Histology glioma set with ...read more
ZC3H15 activates the EGFR-mediated signaling pathway by increasing EGFR protein stability.A Western blot analysis was performed to detect the expression of EGFR signaling proteins (EGFR, p-EGFR, AKT, p-AKT) of GBM ...read more
ZC3H15 activates the EGFR-mediated signaling pathway by increasing EGFR protein stability.A Western blot analysis was performed to detect the expression of EGFR signaling proteins (EGFR, p-EGFR, AKT, p-AKT) of GBM ...read more
ZC3H15 activates the EGFR-mediated signaling pathway by increasing EGFR protein stability.A Western blot analysis was performed to detect the expression of EGFR signaling proteins (EGFR, p-EGFR, AKT, p-AKT) of GBM ...read more
ZC3H15 stabilized c-Myc by mediating its ubiquitination degradation.A, B ZC3H15-knockdown HGC-27 and MKN-45 cells were treated with or without MG-132 for 8 h before harvesting. Western blot assays were performed to ...read more
ZC3H15 stabilized c-Myc by mediating its ubiquitination degradation.A, B ZC3H15-knockdown HGC-27 and MKN-45 cells were treated with or without MG-132 for 8 h before harvesting. Western blot assays were performed to ...read more
ZC3H15 promoted GC progression by increasing c-Myc expression.A GSEA enrichment plots of c-Myc target genes in high ZC3H15 expression versus low ZC3H15 expression TCGA GCs. Normalized enrichment score (NES), false ...read more
ZC3H15 was upregulated in GC and high expression of ZC3H15 was correlated with poor patient prognosis.A Up-regulation of ZC3H15 was found in 8 of 20 cancer types. B, C The level of ZC3H15 mRNA was significantly ...read more
ZC3H15 activates the EGFR-mediated signaling pathway by increasing EGFR protein stability.A Western blot analysis was performed to detect the expression of EGFR signaling proteins (EGFR, p-EGFR, AKT, p-AKT) of GBM ...read more
ZC3H15 stabilized c-Myc by mediating its ubiquitination degradation.A, B ZC3H15-knockdown HGC-27 and MKN-45 cells were treated with or without MG-132 for 8 h before harvesting. Western blot assays were performed to ...read more
ZC3H15 stabilized c-Myc by mediating its ubiquitination degradation.A, B ZC3H15-knockdown HGC-27 and MKN-45 cells were treated with or without MG-132 for 8 h before harvesting. Western blot assays were performed to ...read more
ZC3H15 activates the EGFR-mediated signaling pathway by increasing EGFR protein stability.A Western blot analysis was performed to detect the expression of EGFR signaling proteins (EGFR, p-EGFR, AKT, p-AKT) of GBM ...read more
ZC3H15 is commonly upregulated in GBM and correlates with poor prognosis.A, B ZC3H15 gene expression was obtained from TCGA and CGGA database. Box plot of ZC3H15 expression levels in Grade and Histology glioma set with ...read more
ZC3H15 promoted GC progression by increasing c-Myc expression.A GSEA enrichment plots of c-Myc target genes in high ZC3H15 expression versus low ZC3H15 expression TCGA GCs. Normalized enrichment score (NES), false ...read more
ZC3H15 promoted GC progression by increasing c-Myc expression.A GSEA enrichment plots of c-Myc target genes in high ZC3H15 expression versus low ZC3H15 expression TCGA GCs. Normalized enrichment score (NES), false ...read more
ZC3H15 was upregulated in GC and high expression of ZC3H15 was correlated with poor patient prognosis.A Up-regulation of ZC3H15 was found in 8 of 20 cancer types. B, C The level of ZC3H15 mRNA was significantly ...read more
ZC3H15 promoted the colony formation and tumor growth of GC cells.A Soft agar assays were performed to detect the colony formation ability of GC cells. B, C Xenograft assays were performed in ZC3H15-knockdown HGC-27 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, Mycoplasma
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

ZC3H15 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IVCKHFLEAIENNKYGWFWVCPGGGDICMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERERSALGPNVTKITL
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZC3H15
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZC3H15 Protein (NBP1-81312PEP)
Publications
Read Publications using
NBP1-81312 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZC3H15 Antibody - BSA Free

  • DFRP1
  • DRG family-regulatory protein 1
  • HT010
  • LEREPO4MSTP012
  • Likely ortholog of mouse immediate early response erythropoietin 4
  • zinc finger CCCH domain-containing protein 15
  • zinc finger CCCH-type containing 15

Background

Protects DRG1 from proteolytic degradation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86636
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89461
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-86745
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80963
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-31844
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-80871
Species: Hu
Applications: IHC,  IHC-P
NBP1-82591
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00006690-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for ZC3H15 Antibody (NBP1-81312)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IF/IHC, WB.


Filter By Application
IF/IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ZC3H15 Antibody (NBP1-81312) (0)

There are no reviews for ZC3H15 Antibody (NBP1-81312). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZC3H15 Antibody (NBP1-81312) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZC3H15 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ZC3H15