DRG1 Antibody

Images

 
Western Blot: DRG1 Antibody [NBP1-82591] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more
Immunohistochemistry-Paraffin: DRG1 Antibody [NBP1-82591] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Western Blot: DRG1 Antibody [NBP1-82591] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DRG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DRG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DRG1 Protein (NBP1-82591PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DRG1 Antibody

  • developmentally regulated GTP binding protein 1
  • developmentally regulated GTP-binding protein 1
  • developmentally-regulated GTP-binding protein 1
  • DKFZp434N1827
  • DRG-1
  • NEDD3
  • NEDD-3
  • Neural precursor cell expressed developmentally down-regulated protein 3
  • neural precursor cell expressed, developmentally down-regulated 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-89461
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB6858
Species: Hu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-38971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82591
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DRG1 Antibody (NBP1-82591) (0)

There are no publications for DRG1 Antibody (NBP1-82591).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DRG1 Antibody (NBP1-82591) (0)

There are no reviews for DRG1 Antibody (NBP1-82591). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DRG1 Antibody (NBP1-82591) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DRG1 Products

Bioinformatics Tool for DRG1 Antibody (NBP1-82591)

Discover related pathways, diseases and genes to DRG1 Antibody (NBP1-82591). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DRG1 Antibody (NBP1-82591)

Discover more about diseases related to DRG1 Antibody (NBP1-82591).
 

Pathways for DRG1 Antibody (NBP1-82591)

View related products by pathway.

PTMs for DRG1 Antibody (NBP1-82591)

Learn more about PTMs related to DRG1 Antibody (NBP1-82591).

Blogs on DRG1

There are no specific blogs for DRG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DRG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DRG1