Dock5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Dock5 Antibody [NBP2-58673] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dock5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Dock5 Antibody - BSA Free (NBP2-58673) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VELSVLFCKFIQSIPDNQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEASSQLL
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DOCK5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Dock5 Recombinant Protein Antigen (NBP2-58673PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Dock5 Antibody - BSA Free

• dedicator of cytokinesis 5
• dedicator of cytokinesis protein 5
• DKFZp451J181
• DKFZp779M164
• DKFZp781J211
• FLJ21034

Background

Dock5 (Dedicator of cytokinesis 5) is a potential guanine nucleotide exchange factor (GEF).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DOCK5