DNCIC1 Antibody - BSA Free

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells, cells in molecular layer and cells in granular layer.

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: DNCIC1 Antibody [NBP2-38933] - Staining in human cerebral cortex and lymph node tissues using anti-DYNC1I1 antibody. Corresponding DYNC1I1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNCIC1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNCIC1 Antibody - BSA Free (NBP2-38933) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LQSDSELGRRLHKLGVSKVTQVDFLPREVVSYSKETQTPLATHQSEEDEEDEE
• Predicted Species: Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DYNC1I1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DNCIC1 Protein (NBP2-38933PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNCIC1 Antibody - BSA Free

• cytoplasmic dynein 1 intermediate chain 1
• Cytoplasmic dynein intermediate chain 1
• DNCI1cytoplasmic, intermediate polypeptide 1
• DNCIC1DH IC-1
• Dynein intermediate chain 1, cytosolic
• dynein, cytoplasmic 1, intermediate chain 1

Background

Eukaryotic cells rely on actin and microtubule-based protein "motors" to generate intracellular movements.4 These protein "motors" contain specialized domains that hydrolyse ATP to produce force and movement along a cytoskeletal polymer (actin in the case of myosin family and microtubules in the case of the kinesin family and dyneins). The minus-end-directed, microtubule motor, dynein ATPase is one of the most widely studied microtubule-associated energy transducing enzymes. It constitutes the outer and inner arms on the doublet tubules of sperm flagellar axonemes, where it generates the sliding between doublets that underlies flagellar beating. Dynein has also been implicated in cytoplasmic motile functions, including chromosomal movement, retrograde organelle and axonal transport, the endocytic pathway, and the organization of the Golgi apparatus. In all cell types, dynein has the same basic structures and is composed of two or three distinct heavy chains (approximately 450 kDa), three intermediate chains (70-125 kDa), and at least four light chains (15-25 kDa).5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DYNC1I1
• Uniprot:
  • O14576(Human)