SLC25A13 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Analysis in human liver and skeletal muscle tissues using NBP1-89019 antibody. Corresponding SLC25A13 RNA-seq data are presented for the same tissues.

Western Blot: SLC25A13 Antibody [NBP1-89019] - Analysis in human cell line NTERA-2.

Immunocytochemistry/Immunofluorescence: SLC25A13 Antibody [NBP1-89019] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: SLC25A13 Antibody [NBP1-89019] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC25A13 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC25A13 Antibody - BSA Free (NBP1-89019) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-SLC25A13 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLIS
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC25A13
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
  See Simple Western Antibody Database for Simple Western validation: Tested in Liver, separated by Size
• Control Peptide:

  SLC25A13 Protein (NBP1-89019PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31056400).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC25A13 Antibody - BSA Free

• ARALAR2CTLN2
• calcium-binding mitochondrial carrier protein Aralar2
• CITRIN
• Mitochondrial aspartate glutamate carrier 2
• Solute carrier family 25 member 13
• solute carrier family 25, member 13 (citrin)

Background

The SLC25A13 gene is a member of the mitochondrial carrier family. The encoded protein contains four EF-hand Ca(2+) binding motifs in the N-terminal domain, and localizes to mitochondria. The protein catalyzes the exchange of aspartate for glutamate and a proton

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC25A13 Antibody (NBP1-89019)(1)

Publication using NBP1-89019

• Yang M, Jin Y, Fan S et al. mRNA Therapy Improves Metabolic and Behavioral Abnormalities in a Murine Model of Citrin Deficiency Mol. Ther. 2019-04-23 [PMID: 31056400] (ICC/IF, Simple Western, Human, Mouse)

Bioinformatics

• Gene Symbol: SLC25A13