DYNC1I2 Antibody - BSA Free

Western Blot: DYNC1I2 Antibody [NBP2-38469] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: DYNC1I2 Antibody [NBP2-38469] - Staining of human cell line HEK 293 shows positivity in cytoplasm and aggresome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DYNC1I2 Antibody [NBP2-38469] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: DYNC1I2 Antibody [NBP2-38469] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: DYNC1I2 Antibody [NBP2-38469] - Staining of human liver shows no positivity in hepatocytes.

Immunohistochemistry-Paraffin: DYNC1I2 Antibody [NBP2-38469] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DYNC1I2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DYNC1I2 Antibody - BSA Free (NBP2-38469) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HSDSDLGRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEE
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DYNC1I2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DYNC1I2 Protein (NBP2-38469PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DYNC1I2 Antibody - BSA Free

• cytoplasmic dynein 1 intermediate chain 2
• Cytoplasmic dynein intermediate chain 2
• DH IC-2
• DNCI2MGC104199
• DNCIC2
• Dynein intermediate chain 2, cytosolic
• dynein, cytoplasmic 1, intermediate chain 2
• dynein, cytoplasmic, intermediate polypeptide 2
• FLJ21089
• FLJ90842
• IC2
• MGC111094
• MGC9324

Background

The intermediate chains seem to help dynein bind to dynactin 150 kDa component

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DYNC1I2
• Uniprot:
  • Q13409(Human)