DNAJC2 Antibody

Images

 
Western Blot: DNAJC2 Antibody [NBP1-82627] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DNAJC2 Antibody [NBP1-82627] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: DNAJC2 Antibody [NBP1-82627] - Staining of human testis shows cytoplasmic positivity in seminiferous ducts.
Western Blot: DNAJC2 Antibody [NBP1-82627] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNAJC2 Protein (NBP1-82627PEP)
Publications
Read Publications using
NBP1-82627 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAJC2 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 2
  • dnaJ homolog subfamily C member 2
  • MPHOSPH11M-phase phosphoprotein 11
  • MPP11Zuotin-related factor 1
  • ZRF1zuotin
  • ZUO1
  • zuotin related factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBL1-16438
Species: Hu
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-952
Species: Hu, Mu, Rt, Po, Ba, Ha, Pm, Rb
Applications: WB, Flow, IHC, IHC-P, IP, IF
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56314
Species: Hu
Applications: ICC/IF
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00084727-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DNAJC2 Antibody (NBP1-82627)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for DNAJC2 Antibody (NBP1-82627) (0)

There are no reviews for DNAJC2 Antibody (NBP1-82627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJC2 Antibody (NBP1-82627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC2 Products

Bioinformatics Tool for DNAJC2 Antibody (NBP1-82627)

Discover related pathways, diseases and genes to DNAJC2 Antibody (NBP1-82627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC2 Antibody (NBP1-82627)

Discover more about diseases related to DNAJC2 Antibody (NBP1-82627).
 

Pathways for DNAJC2 Antibody (NBP1-82627)

View related products by pathway.

PTMs for DNAJC2 Antibody (NBP1-82627)

Learn more about PTMs related to DNAJC2 Antibody (NBP1-82627).

Blogs on DNAJC2

There are no specific blogs for DNAJC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC2