DNAJC2 Antibody - BSA Free

Western Blot: DNAJC2 Antibody [NBP1-82627] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: DNAJC2 Antibody [NBP1-82627] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DNAJC2 Antibody [NBP1-82627] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.

Western Blot: DNAJC2 Antibody [NBP1-82627] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: DNAJC2 Antibody [NBP1-82627] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: DNAJC2 Antibody [NBP1-82627] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNAJC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit DNAJC2 Antibody - BSA Free (NBP1-82627) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-DNAJC2 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockout Validated Reported in scientific literature (PMID: 31230751)
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DNAJC2 Protein (NBP1-82627PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for DNAJC2 Antibody - BSA Free

• DnaJ (Hsp40) homolog, subfamily C, member 2
• dnaJ homolog subfamily C member 2
• MPHOSPH11M-phase phosphoprotein 11
• MPP11Zuotin-related factor 1
• ZRF1zuotin
• ZUO1
• zuotin related factor 1

Background

DNAJC2 is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DNAJC2 Antibody (NBP1-82627)(3)

Publications using NBP1-82627

• Helary L, Castille J, Passet B et al. DNAJC2 is required for mouse early embryonic development Biochem. Biophys. Res. Commun. 2019-06-20 [PMID: 31230751] (WB, Knockout Validated, Mouse)
• de Brito BS, Giovanelli N, Egal ES et al. Loss Expression of Plag1 in Malignant Transformation from Pleomorphic Adenoma to Carcinoma Ex-Pleomorphic Adenoma Hum. Pathol. 2016-07-26 [PMID: 27473265] (WB, Human)
• Rath SK, Deb M, Sengupta D et al. Silencing of ZRF1 impedes survival of estrogen receptor positive MCF-7 cells and potentiates the effect of curcumin. Tumour Biol 2016-09-01 [PMID: 27350366] (Human)

Bioinformatics

• Gene Symbol: DNAJC2