SPSB2 Antibody (1E6)

Images

 
Western Blot: SPSB2 Antibody (1E6) [H00084727-M01] - GRCC9 monoclonal antibody (M01), clone 1E6 Analysis of SPSB2 expression in A-549.
Immunohistochemistry-Paraffin: SPSB2 Antibody (1E6) [H00084727-M01] - Analysis of monoclonal antibody to SPSB2 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
Sandwich ELISA: SPSB2 Antibody (1E6) [H00084727-M01] - Detection limit for recombinant GST tagged SPSB2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
1E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SPSB2 Antibody (1E6) Summary

Immunogen
GRCC9 (AAH02983, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag.MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGA QRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGY SRGLHA
Localization
Cytoplasmic
Specificity
SPSB2 - likely ortholog of mouse gene rich cluster, C9 gene
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPSB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SPSB2 Antibody (1E6)

  • FLJ17395
  • Gene-rich cluster protein C9
  • GRCC9MGC2519
  • splA/ryanodine receptor domain and SOCS box containing 2
  • SPRY domain-containing SOCS box protein SSB-2
  • SSB-2
  • SSB2SPRY domain-containing SOCS box protein 2

Background

Interacts with PARW and MET.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-16438
Species: Hu
NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-33548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-86998
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-57439
Species: Hu
Applications: ICC/IF
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-13376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
H00084727-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for SPSB2 Antibody (H00084727-M01) (0)

There are no publications for SPSB2 Antibody (H00084727-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPSB2 Antibody (H00084727-M01) (0)

There are no reviews for SPSB2 Antibody (H00084727-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPSB2 Antibody (H00084727-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPSB2 Products

Bioinformatics Tool for SPSB2 Antibody (H00084727-M01)

Discover related pathways, diseases and genes to SPSB2 Antibody (H00084727-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPSB2 Antibody (H00084727-M01)

Discover more about diseases related to SPSB2 Antibody (H00084727-M01).
 

Pathways for SPSB2 Antibody (H00084727-M01)

View related products by pathway.

PTMs for SPSB2 Antibody (H00084727-M01)

Learn more about PTMs related to SPSB2 Antibody (H00084727-M01).
 

Research Areas for SPSB2 Antibody (H00084727-M01)

Find related products by research area.

Blogs on SPSB2

There are no specific blogs for SPSB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPSB2 Antibody (1E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SPSB2
Entrez
Uniprot