![Western Blot: SPSB1 Antibody [NBP2-86827] - WB Suggested Anti-SPSB1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung](http://images.novusbio.com/fullsize/SPSB1-Antibody-Western-Blot-NBP2-86827-img0001.jpg "Western Blot: SPSB1 Antibody [NBP2-86827] - WB Suggested Anti-SPSB1 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Lung")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit SPSB1 Antibody - BSA Free (NBP2-86827) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SPSB1. Peptide sequence: RGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPSB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunocytochemistry__Immunofluorescence_21675.jpg)
![Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Immunohistochemistry_6763.jpg)
![Knockout Validated HGFR/c-MET Antibody [Unconjugated]](https://images.novusbio.com/images2/HGF_R_AF276_Knockout_Validated_22522.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SPSB1 Antibody (NBP2-86827)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SPSB1 |
![Western Blot: SPSB1 Antibody [NBP2-86827] - Host: Rabbit. Target: SPSB1. Positive control (+): Human Liver (LI). Negative control (-): Human Brain (BR). Antibody concentration: 1ug/ml](http://images.novusbio.com/fullsize/SPSB1-Antibody-Western-Blot-NBP2-86827-img0002.jpg "Western Blot: SPSB1 Antibody [NBP2-86827] - Host: Rabbit. Target: SPSB1. Positive control (+): Human Liver (LI). Negative control (-): Human Brain (BR). Antibody concentration: 1ug/ml")
![Western Blot CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CIS-1_AF3194_Western_Blot_5249.jpg)
![Immunocytochemistry CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3194_human-cis-1-affinity-purified-polyclonal-ab-immunocytochemistry-309202194844.jpg)
![Simple Western CISH/CIS-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af3194_human-cis-1-affinity-purified-polyclonal-ab-simple-western-1342022124434.jpg)
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
