Dihydrolipoamide Dehydrogenase/DLD Antibody

Images

 
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Staining of human colon shows strong cytoplasmic positivity, seen with a granular pattern in glandular cells.
Western Blot: Dihydrolipoamide Dehydrogenase/DLD Antibody [NBP2-13926] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dihydrolipoamide Dehydrogenase/DLD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DVVAGPMLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGK SEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
Dihydrolipoamide Dehydrogenase/DLD Protein (NBP2-13926PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dihydrolipoamide Dehydrogenase/DLD Antibody

  • 2-oxo-glutarate complex, branched chain keto acid dehydrogenase complex)
  • branched chain keto acid dehydrogenase complex
  • Diaphorase
  • dihydrolipoamide dehydrogenase (E3 component of pyruvate dehydrogenase complex
  • Dihydrolipoamide Dehydrogenase
  • dihydrolipoamide dehydrogenasemitochondrial
  • DLD
  • DLDD
  • DLDH
  • E3 component of pyruvate dehydrogenase complex, 2-oxo-glutarate complex
  • E3
  • EC 1.8.1
  • EC 1.8.1.4
  • GCSL
  • Glycine cleavage system L protein
  • glycine cleavage system protein L
  • LAD
  • Lipoamide Dehydrogenase
  • lipoamide reductase
  • lipoyl dehydrogenase
  • PHE3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP2-13926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926) (0)

There are no publications for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926) (0)

There are no reviews for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dihydrolipoamide Dehydrogenase/DLD Products

Bioinformatics Tool for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926)

Discover related pathways, diseases and genes to Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926)

Discover more about diseases related to Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926).
 

Pathways for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926)

View related products by pathway.

PTMs for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926)

Learn more about PTMs related to Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926).
 

Research Areas for Dihydrolipoamide Dehydrogenase/DLD Antibody (NBP2-13926)

Find related products by research area.

Blogs on Dihydrolipoamide Dehydrogenase/DLD

There are no specific blogs for Dihydrolipoamide Dehydrogenase/DLD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dihydrolipoamide Dehydrogenase/DLD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLD
Entrez