DIAPH-2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining in human placenta and pancreas tissues using anti-DIAPH2 antibody. Corresponding DIAPH2 RNA-seq data are presented ...read more
Western Blot: DIAPH-2 Antibody [NBP1-85217] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: DIAPH-2 Antibody [NBP1-85217] - Staining of human cell line U-251 MG shows localization to nucleoli, endoplasmic reticulum and vesicles. Antibody staining is shown in green.
Western Blot: DIAPH-2 Antibody [NBP1-85217] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining of human placenta shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DIAPH-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIAPH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF, WB reported in scientific literature (PMID: 27922008). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
DIAPH-2 Protein (NBP1-85217PEP)
Publications
Read Publications using
NBP1-85217 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIAPH-2 Antibody

  • DIA2
  • DIAdiaphanous (Drosophila, homolog) 2
  • DIAPH2
  • DIAPH-2
  • diaphanous homolog 2 (Drosophila)
  • Diaphanous-related formin-2
  • diaphorase-2
  • DRF2
  • POF
  • POF2
  • POF2FLJ11167
  • protein diaphanous homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB600-231
Species: Hu
Applications: IHC, IHC-P, KD, WB
NB100-1277
Species: Bv, Ma, Hu, Mu
Applications: ChIP, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
7734-LF
Species: Hu
Applications: BA
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-80419
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP2-36489
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-02705
Species: Ca, Hu, Pm, Pm
Applications: Flow, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-32259
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB

Publications for DIAPH-2 Antibody (NBP1-85217)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DIAPH-2 Antibody (NBP1-85217) (0)

There are no reviews for DIAPH-2 Antibody (NBP1-85217). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DIAPH-2 Antibody (NBP1-85217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIAPH-2 Products

Bioinformatics Tool for DIAPH-2 Antibody (NBP1-85217)

Discover related pathways, diseases and genes to DIAPH-2 Antibody (NBP1-85217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIAPH-2 Antibody (NBP1-85217)

Discover more about diseases related to DIAPH-2 Antibody (NBP1-85217).
 

Pathways for DIAPH-2 Antibody (NBP1-85217)

View related products by pathway.

PTMs for DIAPH-2 Antibody (NBP1-85217)

Learn more about PTMs related to DIAPH-2 Antibody (NBP1-85217).
 

Research Areas for DIAPH-2 Antibody (NBP1-85217)

Find related products by research area.

Blogs on DIAPH-2

There are no specific blogs for DIAPH-2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIAPH-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIAPH2
Entrez
Uniprot