DIAPH-2 Antibody

Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining in human placenta and pancreas tissues using anti-DIAPH2 antibody. Corresponding DIAPH2 RNA-seq data are presented for the same tissues.

Western Blot: DIAPH-2 Antibody [NBP1-85217] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: DIAPH-2 Antibody [NBP1-85217] - Staining of human cell line U-251 MG shows localization to nucleoli, endoplasmic reticulum and vesicles. Antibody staining is shown in green.

Western Blot: DIAPH-2 Antibody [NBP1-85217] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining of human placenta shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

DIAPH-2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DIAPH2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, WB reported in scientific literature (PMID: 27922008). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 126 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  DIAPH-2 Protein (NBP1-85217PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DIAPH-2 Antibody

• DIA2
• DIAdiaphanous (Drosophila, homolog) 2
• DIAPH2
• DIAPH-2
• diaphanous homolog 2 (Drosophila)
• Diaphanous-related formin-2
• diaphorase-2
• DRF2
• POF
• POF2
• POF2FLJ11167
• protein diaphanous homolog 2

Background

DIAPH2 may play a role in the development and normal function of the ovaries. Mutations of this gene have been linked to premature ovarian failure. Alternative splicing results in two protein isoforms. Furthermore, each splice variant undergoes additional splicing in the 3' UTR. Overall 4 splice variants have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DIAPH-2 Antibody (NBP1-85217)(2)

Publications using NBP1-85217

• Erasmus JC, Bruche S, Pizarro L et al. Defining functional interactions during biogenesis of epithelial junctions. Nat Commun. 2016-12-06 [PMID: 27922008] (ICC/IF, WB, Human)
• Shinohara R, Thumkeo D, Kamijo H et al. A role for mDia, a Rho-regulated actin nucleator, in tangential migration of interneuron precursors. Nat Neurosci 2012-01-01 [PMID: 22246438]

Bioinformatics

• Gene Symbol: DIAPH2
• Entrez:
  • 1730(Human)
• Uniprot:
  • O60879()