DIAPH-2 Antibody

Images

 
Western Blot: DIAPH-2 Antibody [NBP1-85217] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: DIAPH-2 Antibody [NBP1-85217] - Staining of human cell line U-251 MG shows localization to nucleoli, endoplasmic reticulum & vesicles.
Immunohistochemistry-Paraffin: DIAPH-2 Antibody [NBP1-85217] - Staining of human testis shows cytoplasmic positivity in cells of seminiferus ducts.
Western Blot: DIAPH-2 Antibody [NBP1-85217] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DIAPH-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGSEEPGGGRSNKRSAGNRAANEEETKNKPKLNIQIKTLADDVRDRITSFRKSTVKKEKPLIQHPIDSQVAMSEFPAAQPLYDERSLNLSEKEVLDLFEKMMEDMNLNEEKKAPLRNKDFTTKREMVVQYISAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIAPH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
126 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
DIAPH-2 Protein (NBP1-85217PEP)
Publications
Read Publications using
NBP1-85217 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DIAPH-2 Antibody

  • DIA2
  • DIAdiaphanous (Drosophila, homolog) 2
  • DIAPH2
  • DIAPH-2
  • diaphanous homolog 2 (Drosophila)
  • Diaphanous-related formin-2
  • diaphorase-2
  • DRF2
  • POF
  • POF2
  • POF2FLJ11167
  • protein diaphanous homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB600-230
Species: Hu
Applications: WB
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00081624-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP2-02705
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32259
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for DIAPH-2 Antibody (NBP1-85217)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for DIAPH-2 Antibody (NBP1-85217) (0)

There are no reviews for DIAPH-2 Antibody (NBP1-85217). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DIAPH-2 Antibody (NBP1-85217) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DIAPH-2 Products

Bioinformatics Tool for DIAPH-2 Antibody (NBP1-85217)

Discover related pathways, diseases and genes to DIAPH-2 Antibody (NBP1-85217). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DIAPH-2 Antibody (NBP1-85217)

Discover more about diseases related to DIAPH-2 Antibody (NBP1-85217).
 

Pathways for DIAPH-2 Antibody (NBP1-85217)

View related products by pathway.

PTMs for DIAPH-2 Antibody (NBP1-85217)

Learn more about PTMs related to DIAPH-2 Antibody (NBP1-85217).
 

Research Areas for DIAPH-2 Antibody (NBP1-85217)

Find related products by research area.

Blogs on DIAPH-2

There are no specific blogs for DIAPH-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DIAPH-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIAPH2
Entrez
Uniprot