Dermatopontin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Dermatopontin Antibody [NBP2-56549] - Staining of human cell line SH-SY5Y shows localization to vesicles. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Dermatopontin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCP
• Predicted Species: Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Dermatopontin Recombinant Protein Antigen (NBP2-56549PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Dermatopontin Antibody - BSA Free

• Dermatopontin
• DPT
• Eq1
• TRAMP
• Tyrosine-rich acidic matrix protein

Background

Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPT