LMBR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LMBR1 Antibody [NBP1-89276] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: LMBR1 Antibody [NBP1-89276] - Staining of human duodenum shows strong positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LMBR1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LMBR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
LMBR1 Protein (NBP1-89276PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LMBR1 Antibody

  • ACHPchromosome 7 open reading frame 2
  • C7orf2FLJ11665
  • DIF14
  • Differentiation-related gene 14 protein
  • limb region 1 homolog (mouse)
  • limb region 1 protein homolog
  • PPD2
  • TPT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-06672
Species: Hu
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-68135
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp

Publications for LMBR1 Antibody (NBP1-89276) (0)

There are no publications for LMBR1 Antibody (NBP1-89276).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LMBR1 Antibody (NBP1-89276) (0)

There are no reviews for LMBR1 Antibody (NBP1-89276). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LMBR1 Antibody (NBP1-89276) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LMBR1 Products

Bioinformatics Tool for LMBR1 Antibody (NBP1-89276)

Discover related pathways, diseases and genes to LMBR1 Antibody (NBP1-89276). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LMBR1 Antibody (NBP1-89276)

Discover more about diseases related to LMBR1 Antibody (NBP1-89276).
 

Pathways for LMBR1 Antibody (NBP1-89276)

View related products by pathway.

Blogs on LMBR1

There are no specific blogs for LMBR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LMBR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LMBR1