![Western Blot: DPS Antibody [NBP1-85511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://images.novusbio.com/fullsize2/DPS-Antibody-Western-Blot-NBP1-85511-img0004.jpg "Western Blot: DPS Antibody [NBP1-85511] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLT |
| Predicted Species | Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDSS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-Paraffin-NBP3-15868-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP3-15868-img0002.jpg)
-Immunohistochemistry-NBP3-15868-img0003.jpg)
-Immunohistochemistry-Frozen-NB600-534-img0003.jpg)
-Immunohistochemistry-Paraffin-NB600-534-img0001.jpg)
-Flow-Cytometry-NB600-534-img0002.jpg)
-Flow-Cytometry-NBP2-03227-img0001.jpg)
-Flow-Cytometry-NBP2-03227-img0002.jpg)
-Western-Blot-NBP2-03227-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for DPS Antibody (NBP1-85511)Discover more about diseases related to DPS Antibody (NBP1-85511).
| Pathways for DPS Antibody (NBP1-85511)View related products by pathway.
|
PTMs for DPS Antibody (NBP1-85511)Learn more about PTMs related to DPS Antibody (NBP1-85511).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDSS1 |
![Immunohistochemistry-Paraffin: DPS Antibody [NBP1-85511] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/DPS-Antibody-Immunohistochemistry-Paraffin-NBP1-85511-img0006.jpg "Immunohistochemistry-Paraffin: DPS Antibody [NBP1-85511] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
-ELISA-NBP2-22124-img0001.jpg)
-Flow-Cytometry-NBP2-22124-img0003.jpg)
-Immunocytochemistry-Immunofluorescence-NBP2-22124-img0004.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_555.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_556.jpg)
![IL-6 [HRP]](https://images.novusbio.com/images2/IL6_D6050_ELISA_20.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")