DENND1B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DENND1B Antibody [NBP2-47486] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol.

Immunohistochemistry: DENND1B Antibody [NBP2-47486] - Staining of human colon tissue. Shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DENND1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AFLCGGSGDQAEWNLGQDDSALHGKHLPPSPRKRVSSSGLTDSLFILKEENSNKHLGADNVSDPTSGLDFQLTSPEVSQTD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DENND1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DENND1B Protein (NBP2-47486PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DENND1B Antibody - BSA Free

• C1ORF18
• C1orf218
• chromosome 1 open reading frame 218
• Connecdenn 2
• DENN domain-containing protein 1B
• DENN/MADD domain containing 1B
• DKFZp547O0715
• FAM31BMGC103810
• FLJ20054
• FLJ21179
• FLJ33888
• member B
• Protein FAM31B

Background

DENND1B is a member of the connecdenn family, which links RAB35 activation with the clathrin machinery. The protein functions as a guanine nucleotide exchange factor for RAB35. DENND1B is present at higher levels in dendritic and natural killer cells but at lower levels in the other myeloid lineage cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DENND1B